Gene Information

Name : Desde_3125 (Desde_3125)
Accession : YP_006431210.1
Strain : Desulfitobacterium dehalogenans ATCC 51507
Genome accession: NC_018017
Putative virulence/resistance : Resistance
Product : copper chaperone
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3126681 - 3126875 bp
Length : 195 bp
Strand : -
Note : PFAM: Heavy-metal-associated domain; TIGRFAM: copper ion binding protein

DNA sequence : 
ATGAATCAAACATTAAAAGTTACCGGAATGACCTGCAATCATTGCAAAGCTCATGTGGAAAAAGCGTTGCTGAAAGTTGG
CGGAGTCCAACAAGTGGAGGTGAATTTAGAAAAAGGAGAGGCAGTTGTTGCCGGATCAGCCGGCCGTGAAGACCTGATCA
AGGCTGTGGAAGACGCCGGTTACAGCGCTGATTGA

Protein sequence : 
MNQTLKVTGMTCNHCKAHVEKALLKVGGVQQVEVNLEKGEAVVAGSAGREDLIKAVEDAGYSAD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AFG30122.1 MerP Not tested PAGI-2 Protein 3e-08 50
merP AGK07023.1 MerP Not tested SGI1 Protein 3e-08 50
merP AGK07081.1 MerP Not tested SGI1 Protein 3e-08 50
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 4e-08 50
merP ABQ57373.1 MerP Not tested SGI1 Protein 3e-08 50
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 3e-08 50
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 1e-08 49
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 1e-07 44
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 8e-08 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desde_3125 YP_006431210.1 copper chaperone BAC0231 Protein 2e-08 47
Desde_3125 YP_006431210.1 copper chaperone BAC0679 Protein 6e-08 46
Desde_3125 YP_006431210.1 copper chaperone BAC0678 Protein 5e-08 44
Desde_3125 YP_006431210.1 copper chaperone BAC0675 Protein 1e-06 41