Gene Information

Name : Terro_3067 (Terro_3067)
Accession : YP_006422634.1
Strain : Terriglobus roseus DSM 18391
Genome accession: NC_018014
Putative virulence/resistance : Resistance
Product : mercuric transport periplasmic protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3714141 - 3714425 bp
Length : 285 bp
Strand : +
Note : PFAM: Heavy-metal-associated domain; TIGRFAM: mercuric transport protein periplasmic component

DNA sequence :
ATGAAACGCTTGCATGCTCTAGCAGCCGCCGCCACTTTCCTGATCGTCTCGTCCTCTGCGTGGGCGGCTCCGACCACAGT
AATTCTCGAAGTGCCGGGTATGACCTGCCCAACCTGCCCAATCACGATCAAGAAGGCTTTGATGAAGGAGCAAGGCGTAT
CGAGCGTCGCTGTTCGGTATGAGAAGAAGGAGCTTGTGGTGTCTTTCGATAATGCAAAGACCACCCCAGCGAAGATCATG
CAGTCAACGGCTTCGGTAGGGTTCCCATCCCAGGTTGCGAAATAA

Protein sequence :
MKRLHALAAAATFLIVSSSAWAAPTTVILEVPGMTCPTCPITIKKALMKEQGVSSVAVRYEKKELVVSFDNAKTTPAKIM
QSTASVGFPSQVAK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-15 57
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-15 57
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-15 57
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-15 57
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-15 57
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 2e-15 57
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 3e-14 54
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 4e-17 51
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-14 50
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-14 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Terro_3067 YP_006422634.1 mercuric transport periplasmic protein BAC0675 Protein 6e-14 56
Terro_3067 YP_006422634.1 mercuric transport periplasmic protein BAC0231 Protein 2e-15 56
Terro_3067 YP_006422634.1 mercuric transport periplasmic protein BAC0678 Protein 4e-15 56
Terro_3067 YP_006422634.1 mercuric transport periplasmic protein BAC0679 Protein 2e-15 54
Terro_3067 YP_006422634.1 mercuric transport periplasmic protein BAC0674 Protein 2e-12 41