Gene Information

Name : Thivi_2169 (Thivi_2169)
Accession : YP_006414244.1
Strain : Thiocystis violascens DSM 198
Genome accession: NC_018012
Putative virulence/resistance : Resistance
Product : putative stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2370188 - 2370766 bp
Length : 579 bp
Strand : +
Note : PFAM: Bacterial stress protein

DNA sequence :
ATGGCCATCAGTTTGAACAAAGGCGGCAACGTCAATCTGAGCAAAGAGGCGCCCAATCTCGAAAACGTCCTCGTGGGCCT
GGGCTGGGACGCGCGCGCGACCGATGGGCAGGCGTTCGATCTCGACGCGAGTCTCTTCATGGTGAAGGAAGACGGCAAGG
TGCCGAGCGACGCCTATTTTATCTTCTACAATCAGAAAACCTCGCCCGAAGGCTCGGTCGAGCACACCGGCGACAACCTG
ACCGGCGCCGGCGAAGGTGACGACGAATCCGTACATGTGACACTGTCGAAGGTGCCGCCCGAGATTCAGCGTCTGGTGAT
CGTGGTCACCATCCACGACGCCGACGCCCGCAGGCAGAATTTCGGCCAGGTCGCCAACGCCTTCGTCCGGGTTGTCAATC
GCGACAACAATCTTGAAGTCGTCCGCTTCGATCTCTCCGAGGACTATTCGACCGAGACCGCGATGATCTTCGGCGAGATC
TACCGGCACGCTGGCGACTGGAAATTCAAGGCCGTGGGCCAGGGATATGCCGGCGGACTCCGTGCGCTCGCCTTGCAACA
CGGCGTCAACGTGGGTTAA

Protein sequence :
MAISLNKGGNVNLSKEAPNLENVLVGLGWDARATDGQAFDLDASLFMVKEDGKVPSDAYFIFYNQKTSPEGSVEHTGDNL
TGAGEGDDESVHVTLSKVPPEIQRLVIVVTIHDADARRQNFGQVANAFVRVVNRDNNLEVVRFDLSEDYSTETAMIFGEI
YRHAGDWKFKAVGQGYAGGLRALALQHGVNVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-61 70
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-61 70
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-61 70
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-60 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-60 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 9e-60 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-60 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-60 64

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thivi_2169 YP_006414244.1 putative stress response protein, TerZ- and CABP1 BAC0390 Protein 4e-64 68
Thivi_2169 YP_006414244.1 putative stress response protein, TerZ- and CABP1 BAC0389 Protein 7e-59 64