Gene Information

Name : Thivi_2166 (Thivi_2166)
Accession : YP_006414241.1
Strain : Thiocystis violascens DSM 198
Genome accession: NC_018012
Putative virulence/resistance : Resistance
Product : putative stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2367396 - 2367992 bp
Length : 597 bp
Strand : +
Note : PFAM: Tellurium resistance protein; Bacterial stress protein

DNA sequence : 
ATGGGTATCAGCCTGCAGAAAGGTCAGAAAATCTCGCTGGAGAAGGAAGCCGGCGGCGGCTTGACCCGTATCGTCATGGG
CCTCGGCTGGGATGCCGCGAAGGGCAAGAGCGGCGGCATGCTGGGCGGTCTCTTCGGCGGTGGCGGTGGCGAGAGCATCG
ATCTCGACGCCTCCTGCCTGCTCTTCGACGAGCCGGGGAATCTGGTCGATACCGTGTGGTTCCGTCAACTGCGCAGCCAG
GATCGCAGCATCGAGCACACCGGCGACAATCGCACCGGCGAGGGCGAAGGCGACGACGAACAGATCAAGGTCGATCTCGC
GGCGGTTCCGGCCAACGTGAAAAGCCTGGTCTTTACCGTCAACAACTTCACCGGCCAGGATTTCTCCAAGGTCGAGAATG
CCTACTGCCGCATCATCAACGGCAGCAATAACAGCGAGATCGCGCGCTACGACCTGAGCTGTCAGGGCAGTCATTCGGCC
ATGATCATGGCGAAGGTCTATCGTCACGGCGGCGAATGGAAGATGCACGCCATCGGCGAGGTCGGACAGGGCCGGACGGC
GGAACAGCTGCTGCCGCAGATCAAGCCGCATCTGTAA

Protein sequence : 
MGISLQKGQKISLEKEAGGGLTRIVMGLGWDAAKGKSGGMLGGLFGGGGGESIDLDASCLLFDEPGNLVDTVWFRQLRSQ
DRSIEHTGDNRTGEGEGDDEQIKVDLAAVPANVKSLVFTVNNFTGQDFSKVENAYCRIINGSNNSEIARYDLSCQGSHSA
MIMAKVYRHGGEWKMHAIGEVGQGRTAEQLLPQIKPHL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 7e-44 53
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-32 46
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-36 45
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-36 45
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-27 43
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-28 42
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-28 42
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thivi_2166 YP_006414241.1 putative stress response protein, TerZ- and CABP1 BAC0392 Protein 2e-35 45
Thivi_2166 YP_006414241.1 putative stress response protein, TerZ- and CABP1 BAC0390 Protein 2e-29 43