Gene Information

Name : Thivi_2164 (Thivi_2164)
Accession : YP_006414239.1
Strain : Thiocystis violascens DSM 198
Genome accession: NC_018012
Putative virulence/resistance : Resistance
Product : putative stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2365939 - 2366517 bp
Length : 579 bp
Strand : +
Note : PFAM: Bacterial stress protein

DNA sequence :
ATGGCAATCAGTTTGCAGAAAGGCGGGAACGTCAGCCTGACCAAGACCGATCCGGGCCTGATCAATGCGCTCGTCGGGCT
GGGTTGGGACGCCCGCTCCACCGATGGCGCGGCCTTCGATCTGGATGCCAGCGTCTTTCTGGTCGGCGAGACCGGCAAGG
TGCTGTCCGACGGGCATTTCATCTTTTACAACCAGAAGACCTCGCCCGATGGCGCCGTGGTCCACTCCGGCGACAACACC
ACCGGTGCCGGCGAAGGCGACGACGAAACCGTCTCGATCAATCTGCCGGGGGTCGACGCTCAGATTCAGCGCATCGTCTT
CGCGGTCACCATCCACGAGGCCGAGACCCGCAACCAGAACTTTGGCATGGTCCGCAACGCCTTCATGCGCGTGCTGAACA
AGGACAGCAACACCGAACTGGCCCGCTTCGATCTGTCGGAGGACTACTCGACCGAGACCGCCATGGTGTTCGGCGAGGTC
TACCGCAACGGCGCGGAATGGAAGTTCAAGGCCGTCGGCCAAGGCTTCGCCGGCGGTCTGAATGCGCTGGCGAAGGACCA
TGGGGTGAATGTTGGCTGA

Protein sequence :
MAISLQKGGNVSLTKTDPGLINALVGLGWDARSTDGAAFDLDASVFLVGETGKVLSDGHFIFYNQKTSPDGAVVHSGDNT
TGAGEGDDETVSINLPGVDAQIQRIVFAVTIHEAETRNQNFGMVRNAFMRVLNKDSNTELARFDLSEDYSTETAMVFGEV
YRNGAEWKFKAVGQGFAGGLNALAKDHGVNVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-64 74
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-64 74
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-64 74
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-62 66
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 9e-58 61
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-57 59
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-57 59
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 9e-57 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thivi_2164 YP_006414239.1 putative stress response protein, TerZ- and CABP1 BAC0390 Protein 5e-67 73
Thivi_2164 YP_006414239.1 putative stress response protein, TerZ- and CABP1 BAC0389 Protein 4e-56 58