Gene Information

Name : USDA257_c17390 (USDA257_c17390)
Accession : YP_006397084.1
Strain : Sinorhizobium fredii USDA 257
Genome accession: NC_018000
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1833534 - 1833917 bp
Length : 384 bp
Strand : +
Note : -

DNA sequence :
ATGCGACCTGGCAGCCGCGATCATGCGAGCGCTCAAATGATCCCGATCAGTTCCGGGGTGCGGGTGTGGATCGCGAGCGG
TCACTGCGACATGCGCAAGGGCATGCAGGGTCTGGCGCTGCTGGTGCAGGAGGGCCTCGGTCGCGATCCGTTTAAGGGCG
ACGTCTTCGTCTTTCGCGGTCGTAGCGGCCGACTGATAAAAGCCCTTTGGCATGATGGGATCGGCCTATCATTGTATGCG
AAACGGCTCGAGCGCGGCCGCTTCATCTGGCCGGCGACGGAGAGTGGCGCGATCGCGCTGACCGCCGGTCAGATGTCCTA
TTTGCTGGAGGGGATTGATTGGCGAAATCCGCAGCAGACCTGGCGGCCGACCAGCGCCGGGTGA

Protein sequence :
MRPGSRDHASAQMIPISSGVRVWIASGHCDMRKGMQGLALLVQEGLGRDPFKGDVFVFRGRSGRLIKALWHDGIGLSLYA
KRLERGRFIWPATESGAIALTAGQMSYLLEGIDWRNPQQTWRPTSAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 3e-25 57
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-27 56
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-27 56
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 9e-26 55
unnamed AAC31493.1 L0014 Not tested LEE Protein 6e-26 55
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 9e-26 55
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 6e-26 55
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 9e-26 55
unnamed AAL99258.1 unknown Not tested LEE Protein 6e-26 55
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 6e-26 55
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 9e-26 55
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-19 54
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-27 54
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-27 54
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-25 54
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 4e-25 54
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 4e-25 54
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-25 54
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 3e-27 53
unnamed AAL08461.1 unknown Not tested SRL Protein 1e-25 53
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-25 49
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-25 49
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-25 49
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 3e-24 47
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 3e-24 47

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
USDA257_c17390 YP_006397084.1 hypothetical protein VFG1709 Protein 2e-26 55
USDA257_c17390 YP_006397084.1 hypothetical protein VFG0792 Protein 2e-26 55
USDA257_c17390 YP_006397084.1 hypothetical protein VFG1517 Protein 5e-20 54
USDA257_c17390 YP_006397084.1 hypothetical protein VFG1698 Protein 3e-26 54
USDA257_c17390 YP_006397084.1 hypothetical protein VFG1665 Protein 1e-27 53
USDA257_c17390 YP_006397084.1 hypothetical protein VFG1052 Protein 6e-26 53
USDA257_c17390 YP_006397084.1 hypothetical protein VFG1737 Protein 1e-25 49