Gene Information

Name : Tsac_1635 (Tsac_1635)
Accession : YP_006392240.1
Strain : Thermoanaerobacterium saccharolyticum JW/SL-YS485
Genome accession: NC_017992
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1707606 - 1708295 bp
Length : 690 bp
Strand : +
Note : KEGG: txy:Thexy_1128 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver r

DNA sequence :
ATGAAAATACTGGCAATAGATGATGAGGAGAAAATCTTGGACGTTATAAAAGCATACCTTGAAAAGGAAGGGTATACTGT
ATTGACCGAAACAAACGGTGCAAATGCTTTAAATGCTTTTAAAACTGTAAATCCAGATTTGGTCATATTAGATTTAATGC
TGCCTGGTGTATCCGGCGAAGAAATATGCAGCAAAATAAGAGCTTTGTCAAAGGTGCCAATTATAATGCTTACAGCTAAA
GTAAGTGAAGATGATAAGGTATATGGTTTTACAATTGGTGCGGATGATTACTTAACGAAGCCATTTAGTCCTCGAGAGTT
GAGGATGAGAGTCAAAGCCATACTTAGAAGGGCAAAAGATGACCTGCCATTAAATGATATATTCATGTTTAATGATGGAG
ACCTTGTAATTGATACAAGATCATACGAAGTGAAAAAGAAAGGCAGGGTCGTCAGTTTAACGCCAAATGAGTACAAGTTG
TTGACTGTGATGGCGCAAAATCCAAACAAAGTATTTACGAGAAGTGAACTTATTGAAAAGGCTTTTGGCTATGATTTTGA
TGGTTTCGATAGGACAATAGACGCCCATATAAAAAACTTGAGGCAAAAGATAGAAGATGATCCTAAAAATCCAAGATATA
TAAAAACTGTGTATGGGGCAGGTTATAAATTTGGTGAAGAAAATGATTAA

Protein sequence :
MKILAIDDEEKILDVIKAYLEKEGYTVLTETNGANALNAFKTVNPDLVILDLMLPGVSGEEICSKIRALSKVPIIMLTAK
VSEDDKVYGFTIGADDYLTKPFSPRELRMRVKAILRRAKDDLPLNDIFMFNDGDLVIDTRSYEVKKKGRVVSLTPNEYKL
LTVMAQNPNKVFTRSELIEKAFGYDFDGFDRTIDAHIKNLRQKIEDDPKNPRYIKTVYGAGYKFGEEND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-40 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-40 49
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-41 46
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 3e-37 44
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 1e-37 44
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 7e-38 44
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 7e-38 44
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-38 44
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-41 43
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-41 43
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-41 43
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-41 43
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-41 43
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-41 43
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-41 43
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-41 43
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-41 43
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-41 43
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-40 43
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 5e-35 42
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 4e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tsac_1635 YP_006392240.1 winged helix family two component transcriptional regulator VFG1702 Protein 8e-41 41