Gene Information

Name : Tsac_1317 (Tsac_1317)
Accession : YP_006391925.1
Strain : Thermoanaerobacterium saccharolyticum JW/SL-YS485
Genome accession: NC_017992
Putative virulence/resistance : Resistance
Product : copper ion binding protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1377103 - 1377327 bp
Length : 225 bp
Strand : +
Note : KEGG: txy:Thexy_0590 copper ion binding protein; TIGRFAM: Copper ion-binding; PFAM: Heavy metal transport/detoxification protein

DNA sequence :
ATGAGTTTATTTGGTCCAAAAGGTGAAACTGTGACGATCGATGTAAGAGGTATGTCGTGCAATCATTGCAAAATGACTGT
AGAAAAAGCATTAAAAGGCCTTGATGGAGTGTCAAAAGCGACAGTAGACTTAGATAAGGCCAATGTCACCGTAACATACG
ATCCTAAAAAAGTTACTATAGATGACATGAAAAAAGCGATAATTGATGCAGGATATGAAGCTTAA

Protein sequence :
MSLFGPKGETVTIDVRGMSCNHCKMTVEKALKGLDGVSKATVDLDKANVTVTYDPKKVTIDDMKKAIIDAGYEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AFG30122.1 MerP Not tested PAGI-2 Protein 1e-10 44
merP AGK07023.1 MerP Not tested SGI1 Protein 1e-10 44
merP AGK07081.1 MerP Not tested SGI1 Protein 1e-10 44
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 9e-10 44
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 2e-10 44
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 6e-10 44
merP ABQ57373.1 MerP Not tested SGI1 Protein 1e-10 44
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 1e-10 44
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 2e-09 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tsac_1317 YP_006391925.1 copper ion binding protein BAC0634 Protein 3e-08 43
Tsac_1317 YP_006391925.1 copper ion binding protein BAC0674 Protein 6e-09 43
Tsac_1317 YP_006391925.1 copper ion binding protein BAC0675 Protein 1e-09 42
Tsac_1317 YP_006391925.1 copper ion binding protein BAC0679 Protein 2e-09 41
Tsac_1317 YP_006391925.1 copper ion binding protein BAC0231 Protein 7e-10 41
Tsac_1317 YP_006391925.1 copper ion binding protein BAC0678 Protein 6e-10 41