Gene Information

Name : Tsac_0010 (Tsac_0010)
Accession : YP_006390647.1
Strain : Thermoanaerobacterium saccharolyticum JW/SL-YS485
Genome accession: NC_017992
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 10832 - 11509 bp
Length : 678 bp
Strand : -
Note : KEGG: txy:Thexy_1908 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver r

DNA sequence :
ATGGAAAACATTTTAATTATCGATGATGAAGAAATGCTTGTAAAGGGATTGAAGCTATCCCTCATTCAAGAAGGTTATTA
CGTTGATTATGCTTATGATGGTGAAGAAGGTTTGGAAAAAATAAAAAATGGCAATTATGATTTAGTAATATTAGATTTGA
TGCTGCCCAAGATCGACGGTCTTACCCTTTGCAAAGAGGTAAGGTCATTTTCAAATATACCTATAATAATGCTTACAGCC
AAAGGTGAAGATGTGGATAAGATAGTAGGCATTGAGATGGGAGCAGATGACTACCTTGCAAAGCCTTTCAATACGCGGGA
ATTGATCGCCAGAATTAGAGCTTTATTCAGACGGACGACGACGCCTTATGTGAAAAAGCACGATGTAATCAAGTTAGGGG
ATATTACGATAAATGTTCCTGACAAGATAGTCCAGAAGAATGGCAAAGACATCGATCTTACAAATAAAGAGTTTGAATTA
TTAGTTCTTTTGGCTTCGAATCCGGGAAAGCTTTATTCTAAGGACAAACTGATGGACTTAATATGGGGATTTGATTTCTA
TGGAGATACGAATACTGTGAATGTCCATATAAGAAAGCTTAGAGAGAAGATTGAAGACGATCCGGCAAATCCAAAGCATA
TTTTTACAAAGTGGGGCTCTGGCTACTACATGAAATAG

Protein sequence :
MENILIIDDEEMLVKGLKLSLIQEGYYVDYAYDGEEGLEKIKNGNYDLVILDLMLPKIDGLTLCKEVRSFSNIPIIMLTA
KGEDVDKIVGIEMGADDYLAKPFNTRELIARIRALFRRTTTPYVKKHDVIKLGDITINVPDKIVQKNGKDIDLTNKEFEL
LVLLASNPGKLYSKDKLMDLIWGFDFYGDTNTVNVHIRKLREKIEDDPANPKHIFTKWGSGYYMK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
sboR YP_006309915.1 SboR Not tested FWisland_1 Protein 6e-33 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-39 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-39 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-51 47
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 3e-36 45
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 3e-36 45
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-44 44
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-44 44
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-44 44
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-44 44
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-44 44
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-44 44
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-44 44
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-44 44
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-44 44
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 6e-44 44
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-39 44
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 4e-38 44
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-40 43
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-40 43
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-40 43
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-40 43
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-40 43
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-40 43
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-40 43
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-40 43
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 2e-34 43
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-38 43
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-38 43
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 4e-36 43
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 7e-34 42
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 4e-37 42
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 9e-33 42
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 1e-38 42
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-39 42
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-35 41
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-37 41
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 5e-32 41
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator VFG1702 Protein 5e-40 41
Tsac_0010 YP_006390647.1 winged helix family two component transcriptional regulator VFG1563 Protein 5e-40 41