Gene Information

Name : YSA_00857 (YSA_00857)
Accession : YP_006384355.1
Strain : Pseudomonas putida ND6
Genome accession: NC_017986
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 430122 - 430700 bp
Length : 579 bp
Strand : -
Note : -

DNA sequence : 
ATGGCTGTCTCGCTGACCAAAGGCTCCAACGTATCGCTTTCTAAAGAAGCTCCTGGCCTGTCCGAAGTGGTCGTTGGCCT
GGGCTGGGACCCTCGTGTAACCGACGGTACCGAGTTTGACCTCGATGCATCCATCTTCATCACCGGTGAAAATGGCAAAG
TACTGAACGACAACAGCTTCATCTTCTACAACAACAAAACCTCGCAAGACGGTTCTGTTGAGCACCTGGGCGACAACCGC
TCCGGCGCGGGTGAAGGCGACGACGAGCAGGTCAACGTCAAGCTGACCGGCCTGGCTGCAGACGTTAAAAAACTGGTTTT
CGCAGTCACCATCCACGAAGCCGAAGGCCGCAAGCAGAGCTTCGGTCAGGTGGGCAACGCCTACATCCGCGTCGTCAACA
AGGCAGACGGTAAAGAGCTGGCGCGCTACGACCTGAGCGAAGACGCTTCGACTGAAACCGCGATGATCTTCGGTGAGCTG
TACCGTCACAACGACGAGTTCAAGTTCAAGGCGATCGGTCAAGGTTTCGCTGGCGGCCTGAAGCCACTGGCTGAAGCCCA
TGGCGTTTCCATCGGCTAA

Protein sequence : 
MAVSLTKGSNVSLSKEAPGLSEVVVGLGWDPRVTDGTEFDLDASIFITGENGKVLNDNSFIFYNNKTSQDGSVEHLGDNR
SGAGEGDDEQVNVKLTGLAADVKKLVFAVTIHEAEGRKQSFGQVGNAYIRVVNKADGKELARYDLSEDASTETAMIFGEL
YRHNDEFKFKAIGQGFAGGLKPLAEAHGVSIG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-80 91
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-63 69
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-63 69
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-63 69
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-61 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-58 62
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 9e-58 62
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-58 62
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 9e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YSA_00857 YP_006384355.1 hypothetical protein BAC0390 Protein 2e-66 71
YSA_00857 YP_006384355.1 hypothetical protein BAC0389 Protein 7e-57 61