Gene Information

Name : TKWG_19915 (TKWG_19915)
Accession : YP_006380745.1
Strain : Advenella kashmirensis WT001
Genome accession: NC_017964
Putative virulence/resistance : Resistance
Product : DMT superfamily multiple drug (Quaternary ammonium compounds) efflux pump
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3430282 - 3430617 bp
Length : 336 bp
Strand : +
Note : COG2076 Membrane transporters of cations and cationic drugs

DNA sequence :
ATGCTCAATATCTATCTTATTCTTGCCATCTCGATCTGTGCCGAGACCCTTGCCACCACGATGATGAAAGCCTCTCACGG
ATTCACCCAGTTAGGCCCGAGCATCGTTGTGGTGATCGGCTATGCCGTTTCCTTTTATGGCCTGTCGCAGGTCGTAAAAA
CCATGAATATCGGCATAGCCTATGCGATCTGGGGCGGCATGGGCATCTTTCTTGTATCGATCATGTCATTTCTGTTTTAT
AAACAGCGACTGGACCTGCCGGCCATTGTGGGCATGCTGTTTATTGCACTTGGCATTGTGATCATTCAGCTTTTTTCAAA
ATCGGTCACGCACTAA

Protein sequence :
MLNIYLILAISICAETLATTMMKASHGFTQLGPSIVVVIGYAVSFYGLSQVVKTMNIGIAYAIWGGMGIFLVSIMSFLFY
KQRLDLPAIVGMLFIALGIVIIQLFSKSVTH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 4e-17 44
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-17 44
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 4e-17 44
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 4e-17 44
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 4e-17 44
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 6e-17 44
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 4e-17 44
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 4e-17 44
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 4e-17 44
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-17 44
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 4e-17 44
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-17 44
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-17 44
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 4e-17 44
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 4e-17 44
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-17 44
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 6e-17 44
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 4e-17 44
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 4e-17 44
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-17 44
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 6e-17 44
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 4e-17 44
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 4e-17 44
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-17 44
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 4e-17 44
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 4e-17 44
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 4e-17 44
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-17 44
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 4e-17 44
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 4e-17 44
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 7e-17 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TKWG_19915 YP_006380745.1 DMT superfamily multiple drug (Quaternary ammonium compounds) efflux pump CP004022.1.gene1549. Protein 1e-23 60
TKWG_19915 YP_006380745.1 DMT superfamily multiple drug (Quaternary ammonium compounds) efflux pump NC_010410.6003348.p0 Protein 2e-22 57
TKWG_19915 YP_006380745.1 DMT superfamily multiple drug (Quaternary ammonium compounds) efflux pump BAC0002 Protein 2e-22 57
TKWG_19915 YP_006380745.1 DMT superfamily multiple drug (Quaternary ammonium compounds) efflux pump BAC0377 Protein 7e-25 55
TKWG_19915 YP_006380745.1 DMT superfamily multiple drug (Quaternary ammonium compounds) efflux pump BAC0150 Protein 7e-20 50
TKWG_19915 YP_006380745.1 DMT superfamily multiple drug (Quaternary ammonium compounds) efflux pump CP001138.1.gene1489. Protein 2e-21 50
TKWG_19915 YP_006380745.1 DMT superfamily multiple drug (Quaternary ammonium compounds) efflux pump NC_002695.1.913273.p Protein 9e-20 49
TKWG_19915 YP_006380745.1 DMT superfamily multiple drug (Quaternary ammonium compounds) efflux pump BAC0324 Protein 2e-20 46
TKWG_19915 YP_006380745.1 DMT superfamily multiple drug (Quaternary ammonium compounds) efflux pump BAC0323 Protein 2e-17 44
TKWG_19915 YP_006380745.1 DMT superfamily multiple drug (Quaternary ammonium compounds) efflux pump BAC0322 Protein 9e-21 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TKWG_19915 YP_006380745.1 DMT superfamily multiple drug (Quaternary ammonium compounds) efflux pump VFG1586 Protein 3e-17 43