Gene Information

Name : cusR (TMO_c0013)
Accession : YP_006373605.1
Strain :
Genome accession: NC_017958
Putative virulence/resistance : Virulence
Product : two component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 15899 - 16603 bp
Length : 705 bp
Strand : +
Note : -

DNA sequence :
ATGGGACATGCGATGAAACTGCTGGTCGTTGAAGACGAGAACAAGACGGCGGATTACGTCCGCCAAGGTCTCATGGAGGC
GGGATTCGTCGTGGATCTGGCGCGCAACGGATTGGACGGACACCACCTGGCCATGGGCGAGACATACGATCTGGTGGTCT
TGGATGTCATGCTGCCGGATGTCGATGGCTGGCGCATCGTGCGTGCCCTTCGAGATGCCGGTAAACAGGTCCCTGTGCTC
TTTCTGACGGCGCGTGGCGGTGTAGACGACCGTGTCAAGGGATTGGAACTGGGAGCGGACGACTACCTCGTCAAGCCATT
CGCGTTCTCTGAGTTGCTGGCGCGGGTGCGGACGCTGCTGCGACGCGGAAGCGCTCCGAGCCAGCCTGATCGCATCCAGG
TTGCCGATTTGGTGCTGGACTTGGCGCGCCGGCGCGCAACGCGCGCTGGCCAACGCATCAATCTCACCAGCAAGGAGTTC
GCGTTGCTTGAGCTCCTGGCCCGTCGCCAGGGGGAGGTCCTTCCACGGTCTCTGATCGCGTCGCAGGTATGGGACATGAA
TTTCGACAGCGACAGCAACGTCATCGATGTAGCCATCCGCCGTCTACGCGCGAAGATAGACGATGCGTTCAATCCGAAGC
TCATCCACACCGTGCGTGGAATGGGATACACGCTCGATGCGCCCGATGATGCCCCTGCGCCATAA

Protein sequence :
MGHAMKLLVVEDENKTADYVRQGLMEAGFVVDLARNGLDGHHLAMGETYDLVVLDVMLPDVDGWRIVRALRDAGKQVPVL
FLTARGGVDDRVKGLELGADDYLVKPFAFSELLARVRTLLRRGSAPSQPDRIQVADLVLDLARRRATRAGQRINLTSKEF
ALLELLARRQGEVLPRSLIASQVWDMNFDSDSNVIDVAIRRLRAKIDDAFNPKLIHTVRGMGYTLDAPDDAPAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-54 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-53 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_006373605.1 two component response regulator BAC0083 Protein 7e-69 71
cusR YP_006373605.1 two component response regulator BAC0111 Protein 6e-72 70
cusR YP_006373605.1 two component response regulator BAC0638 Protein 2e-60 67
cusR YP_006373605.1 two component response regulator BAC0347 Protein 1e-62 65
cusR YP_006373605.1 two component response regulator BAC0197 Protein 8e-61 63
cusR YP_006373605.1 two component response regulator BAC0308 Protein 9e-61 61
cusR YP_006373605.1 two component response regulator BAC0125 Protein 3e-59 61
cusR YP_006373605.1 two component response regulator NC_002516.2.879194.p Protein 4e-27 43
cusR YP_006373605.1 two component response regulator BAC0487 Protein 9e-26 41
cusR YP_006373605.1 two component response regulator NC_003923.1003417.p0 Protein 7e-30 41
cusR YP_006373605.1 two component response regulator NC_013450.8614146.p0 Protein 7e-30 41
cusR YP_006373605.1 two component response regulator NC_002951.3238224.p0 Protein 7e-30 41
cusR YP_006373605.1 two component response regulator NC_007793.3914065.p0 Protein 7e-30 41
cusR YP_006373605.1 two component response regulator NC_002758.1121390.p0 Protein 7e-30 41
cusR YP_006373605.1 two component response regulator NC_010079.5776364.p0 Protein 7e-30 41
cusR YP_006373605.1 two component response regulator NC_002952.2859858.p0 Protein 7e-30 41
cusR YP_006373605.1 two component response regulator NC_007622.3794948.p0 Protein 7e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_006373605.1 two component response regulator VFG0596 Protein 5e-55 59
cusR YP_006373605.1 two component response regulator VFG1390 Protein 3e-38 44