Gene Information

Name : MODMU_0614 (MODMU_0614)
Accession : YP_006364570.1
Strain : Modestobacter marinus BC501
Genome accession: NC_017955
Putative virulence/resistance : Virulence
Product : XRE family transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 622060 - 622320 bp
Length : 261 bp
Strand : -
Note : Evidence 2b : Function of strongly homologous gene; Product type r : regulator

DNA sequence :
GTGAACGAGGGCGTCTTCAACCGGATCACCCTGCTGCGGGCCGAGCAGGGGGTCAGCCGTCGCGAGCTCGCCGACGCCCT
CGGCGTCCACTACCAGACGGTCGGCTACCTCGAGCGCGGCGAGTACAACCCCAGCCTGCACCTGGCGCTGCGGATCGCGG
AGTTCTTCGGGCTGCCGGTCGAGACGGTGTTCTCGACCCGACCGTTCCCGCGGATCAGCGACGCCCCCCACGACGAGCTG
GGTCGCGCCGCCTCCGGCTGA

Protein sequence :
MNEGVFNRITLLRAEQGVSRRELADALGVHYQTVGYLERGEYNPSLHLALRIAEFFGLPVETVFSTRPFPRISDAPHDEL
GRAASG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
DIP0086 NP_938485.1 regulatory protein Not tested Not named Protein 8e-14 45
EF0524 NP_814301.1 Cro/CI family transcriptional regulator Not tested Not named Protein 2e-07 41
ef0042 AAM75247.1 EF0042 Virulence Not named Protein 1e-07 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MODMU_0614 YP_006364570.1 XRE family transcriptional regulator VFG2175 Protein 6e-08 41
MODMU_0614 YP_006364570.1 XRE family transcriptional regulator VFG2168 Protein 6e-08 41