Name : MODMU_0614 (MODMU_0614) Accession : YP_006364570.1 Strain : Modestobacter marinus BC501 Genome accession: NC_017955 Putative virulence/resistance : Virulence Product : XRE family transcriptional regulator Function : - COG functional category : - COG ID : - EC number : - Position : 622060 - 622320 bp Length : 261 bp Strand : - Note : Evidence 2b : Function of strongly homologous gene; Product type r : regulator DNA sequence : GTGAACGAGGGCGTCTTCAACCGGATCACCCTGCTGCGGGCCGAGCAGGGGGTCAGCCGTCGCGAGCTCGCCGACGCCCT CGGCGTCCACTACCAGACGGTCGGCTACCTCGAGCGCGGCGAGTACAACCCCAGCCTGCACCTGGCGCTGCGGATCGCGG AGTTCTTCGGGCTGCCGGTCGAGACGGTGTTCTCGACCCGACCGTTCCCGCGGATCAGCGACGCCCCCCACGACGAGCTG GGTCGCGCCGCCTCCGGCTGA Protein sequence : MNEGVFNRITLLRAEQGVSRRELADALGVHYQTVGYLERGEYNPSLHLALRIAEFFGLPVETVFSTRPFPRISDAPHDEL GRAASG |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
DIP0086 | NP_938485.1 | regulatory protein | Not tested | Not named | Protein | 8e-14 | 45 |
ef0042 | AAM75247.1 | EF0042 | Virulence | Not named | Protein | 1e-07 | 41 |
EF0524 | NP_814301.1 | Cro/CI family transcriptional regulator | Not tested | Not named | Protein | 2e-07 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
MODMU_0614 | YP_006364570.1 | XRE family transcriptional regulator | VFG2168 | Protein | 6e-08 | 41 |
MODMU_0614 | YP_006364570.1 | XRE family transcriptional regulator | VFG2175 | Protein | 6e-08 | 41 |