Gene Information

Name : LLNZ_06985 (LLNZ_06985)
Accession : YP_006356769.1
Strain : Lactococcus lactis NZ9000
Genome accession: NC_017949
Putative virulence/resistance : Resistance
Product : putative tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1325177 - 1325752 bp
Length : 576 bp
Strand : -
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCAGTATCACTTGTAAAAGGTCAACGCACAGATTTAACTAAATCAAATCCCGGTTTAACTCGACTTCATGTTGGCTT
AGGTTGGGATGCTAATCCAATGGATGGTAATGAATTTGATTTAGATGCTCAAGCATTTTTGCTTAATTCAGACGGAAAAG
TTAGAAATGATGATGACTTTATATTTTATAATCATAAAATATCTGAAAATGATGCAGTCATTGCTGGTGAAGATAATCGT
ACAGGTAATGGTGATGGAGATGATGAATCACTTAAAGTTGACTTATCTAAAATACCAACAGATGTTAATAAAATTGATTT
TACTGTAACCATTGATCAATATGATGTTAGACACCAAAATTTTGGGATGGTGAATAATGCATATATTCGAATTGTGAATG
ATGAGACAAATGAAGAATTAATGCGTTATGATCTCTCTGAAGATGCTTCCATTGAGACCGCTATTGTAATGGGAGAAGTG
TATCGAACAAGAAACGAATGGAAGTTTTTACCAGTAGGAGCCGGCTATCAGGGTGGACTTGCAGCGCTTGCCTCTGGTTT
TGGTGTAAATATTTAG

Protein sequence :
MAVSLVKGQRTDLTKSNPGLTRLHVGLGWDANPMDGNEFDLDAQAFLLNSDGKVRNDDDFIFYNHKISENDAVIAGEDNR
TGNGDGDDESLKVDLSKIPTDVNKIDFTVTIDQYDVRHQNFGMVNNAYIRIVNDETNEELMRYDLSEDASIETAIVMGEV
YRTRNEWKFLPVGAGYQGGLAALASGFGVNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-47 59
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-46 56
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-46 56
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-46 56
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-41 55
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-41 55
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-41 55
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-39 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LLNZ_06985 YP_006356769.1 putative tellurium resistance protein BAC0389 Protein 4e-46 56
LLNZ_06985 YP_006356769.1 putative tellurium resistance protein BAC0390 Protein 2e-44 55