Gene Information

Name : ramA (ES15_1175)
Accession : YP_006342259.1
Strain : Cronobacter sakazakii ES15
Genome accession: NC_017933
Putative virulence/resistance : Resistance
Product : transcriptional activator RamA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1253840 - 1254184 bp
Length : 345 bp
Strand : +
Note : COG2207

DNA sequence : 
ATGGAACTTCCCGCTCAGGTTATTGAAACGCTGACCGACTGGATTGATGACAATCTTCATAAGCCGCTGCGCATTGATGA
TATCGCGCGCCACGCGGGTTATTCGAAATGGCATTTGCAGCGGCTTTTTCACCATCATAAAGGGGAGAGCATCGGGCGTT
ATATTCGCGAGAAAAAGCTGCGGCTGGCGGCGCAGGACCTGCGTGCCACCAACGACCGCGTGCTGGATATTTCCATGAAA
TACGGGTTCGATTCTCAGCAAACTTTTACGAGACTCTTCACGCGTAAATATCGGATGTCGCCAGGCACCTGGCGCAAGCA
GGGCGATGCCCCGACCAACCACTGA

Protein sequence : 
MELPAQVIETLTDWIDDNLHKPLRIDDIARHAGYSKWHLQRLFHHHKGESIGRYIREKKLRLAAQDLRATNDRVLDISMK
YGFDSQQTFTRLFTRKYRMSPGTWRKQGDAPTNH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-22 46
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 6e-20 42
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 6e-20 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ramA YP_006342259.1 transcriptional activator RamA CP001138.1.gene612.p Protein 4e-37 67
ramA YP_006342259.1 transcriptional activator RamA CP001918.1.gene327.p Protein 1e-23 48
ramA YP_006342259.1 transcriptional activator RamA CP000647.1.gene4499. Protein 2e-23 46
ramA YP_006342259.1 transcriptional activator RamA CP001138.1.gene4488. Protein 6e-23 46
ramA YP_006342259.1 transcriptional activator RamA CP001918.1.gene2033. Protein 4e-21 45
ramA YP_006342259.1 transcriptional activator RamA NC_002695.1.914293.p Protein 6e-22 44
ramA YP_006342259.1 transcriptional activator RamA BAC0371 Protein 6e-22 44
ramA YP_006342259.1 transcriptional activator RamA CP000647.1.gene1624. Protein 1e-20 44
ramA YP_006342259.1 transcriptional activator RamA BAC0560 Protein 7e-21 44
ramA YP_006342259.1 transcriptional activator RamA NC_002695.1.917339.p Protein 7e-21 44
ramA YP_006342259.1 transcriptional activator RamA CP001138.1.gene1637. Protein 8e-21 44
ramA YP_006342259.1 transcriptional activator RamA CP000034.1.gene1596. Protein 6e-21 44
ramA YP_006342259.1 transcriptional activator RamA CP000034.1.gene4505. Protein 1e-21 43
ramA YP_006342259.1 transcriptional activator RamA NC_010558.1.6276025. Protein 3e-20 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ramA YP_006342259.1 transcriptional activator RamA VFG0585 Protein 5e-23 46
ramA YP_006342259.1 transcriptional activator RamA VFG1038 Protein 2e-20 42