Gene Information

Name : MYA_5224 (MYA_5224)
Accession : YP_006336301.1
Strain :
Genome accession: NC_017922
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system with PhoQ
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 194693 - 195361 bp
Length : 669 bp
Strand : +
Note : -

DNA sequence : 
TTGGTCGAAGACAATCAGCAGGTGGCGGGCTTTCTGAAGAAAGGCCTGCTCGAAACCGGCCACGTCGTCGATTGGGCCGA
CAACGGCCGCGACGGCATGGCGCTCGCGATCGGGGAATCCTACGACGCGATCGTGCTCGACCGCATGCTGCCCGGCGGTA
TCGACGGGCTCAAGATCGTCGCGGCGCTGCGCGCGGCGGGCAGCAAGGTACCCGTGCTGATCCTCAGCGCACTCGACGAA
GTCGACGAACGGATTCGGGGGCTGAAGGCGGGCGGCGACGATTACGTCGTCAAGCCGTTTTCGTTCGGCGAAGTCGTCGC
GCGGCTCGAAGCGCTCGCGCGGCGTTCGCAGGACAACGGCTTCGACACGAAGCTCAAGGTCGGCGATCTCTGCATCGACC
TGCTGTCGCGGAAAGTGACGCGCGCCGGCAATGCGATCCTGCTCAAGCCGCGCGAGTTCAAGCTGCTCGAATATCTGATG
CGCCACGCGGAGCAGGTCGTCACCCGCACGATGCTGCTCGAAAACATCTGGGAATACCATTTCGATCCGCAAACGAACGT
CATCGACGTGCACGTGAGCAAGCTGCGCCAGAAGATCGACACGGGCTTCGACCGCTCGCTGCTGCGGACCATCCGCAACG
CGGGCTACATGCTCACTGCCGCCGACTGA

Protein sequence : 
MVEDNQQVAGFLKKGLLETGHVVDWADNGRDGMALAIGESYDAIVLDRMLPGGIDGLKIVAALRAAGSKVPVLILSALDE
VDERIRGLKAGGDDYVVKPFSFGEVVARLEALARRSQDNGFDTKLKVGDLCIDLLSRKVTRAGNAILLKPREFKLLEYLM
RHAEQVVTRTMLLENIWEYHFDPQTNVIDVHVSKLRQKIDTGFDRSLLRTIRNAGYMLTAAD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-39 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-39 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MYA_5224 YP_006336301.1 response regulator in two-component regulatory system with PhoQ BAC0347 Protein 2e-47 46
MYA_5224 YP_006336301.1 response regulator in two-component regulatory system with PhoQ BAC0111 Protein 4e-51 46
MYA_5224 YP_006336301.1 response regulator in two-component regulatory system with PhoQ BAC0125 Protein 1e-43 45
MYA_5224 YP_006336301.1 response regulator in two-component regulatory system with PhoQ BAC0083 Protein 1e-46 45
MYA_5224 YP_006336301.1 response regulator in two-component regulatory system with PhoQ BAC0197 Protein 4e-45 44
MYA_5224 YP_006336301.1 response regulator in two-component regulatory system with PhoQ BAC0308 Protein 1e-42 43
MYA_5224 YP_006336301.1 response regulator in two-component regulatory system with PhoQ BAC0638 Protein 3e-41 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MYA_5224 YP_006336301.1 response regulator in two-component regulatory system with PhoQ VFG0596 Protein 5e-40 43
MYA_5224 YP_006336301.1 response regulator in two-component regulatory system with PhoQ VFG1389 Protein 6e-33 43