Gene Information

Name : MYA_5186 (MYA_5186)
Accession : YP_006336265.1
Strain :
Genome accession: NC_017922
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 146490 - 147209 bp
Length : 720 bp
Strand : +
Note : -

DNA sequence :
ATGGATCACGCCAAACGCATCCTGATCGTCGAAGACGACGCCGACATCGCCGACGTGTTGAGCCTGCATCTGCGCGACGA
GCGCTACGAAGTCGTCCACAGCGCGGACGGCGCCGAAGGCCTGCGTCTGCTCGAGCAGGGAAACTGGGACGCGCTGATTC
TCGATCTGATGCTGCCGGGCGTCGACGGCCTCGAAATCTGCCGGCGCGCCCGCGCGATGGCGCGCTACACGCCGATCATC
ATCACGAGCGCGCGCTCGAGCGAGGTGCACCGGATTCTCGGCCTCGAACTCGGCGCCGACGATTACCTCGCGAAGCCGTT
CTCGGTGCTGGAGCTGGTCGCGCGCGTGAAGGCGCTGCTGCGGCGCGTCGACGCGCTCGCGCGCGACTCGCGCCTCGACG
CCGGCACGCTCGACGTCGCCGGCCTGTCGATCGATCCGATCGCGCGCGAGGCGAGCGTCGACGGCACGCGCATCGACCTC
ACGCCGCGCGAATTCGACCTGCTGTACTTCTTCGCCCGGCATCCGGGCAAGGTGTTCTCGCGGATGGATCTGCTGAACGC
CGTCTGGGGCTACCGGCACGAAGGCTACGAACATACGGTGAACACGCACATCAACCGGCTGCGCGCGAAGATCGAGGCCG
ATCCCGCCGAGCCCGTGCGGATCCTCACGGTGTGGGGGCGCGGCTACAAGCTGGCCGCACCGGGCCAGCGGGACGCGTGA

Protein sequence :
MDHAKRILIVEDDADIADVLSLHLRDERYEVVHSADGAEGLRLLEQGNWDALILDLMLPGVDGLEICRRARAMARYTPII
ITSARSSEVHRILGLELGADDYLAKPFSVLELVARVKALLRRVDALARDSRLDAGTLDVAGLSIDPIAREASVDGTRIDL
TPREFDLLYFFARHPGKVFSRMDLLNAVWGYRHEGYEHTVNTHINRLRAKIEADPAEPVRILTVWGRGYKLAAPGQRDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-72 62
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-72 62

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MYA_5186 YP_006336265.1 two-component response regulator AE000516.2.gene3505. Protein 6e-39 46
MYA_5186 YP_006336265.1 two-component response regulator NC_012469.1.7685629. Protein 3e-42 46
MYA_5186 YP_006336265.1 two-component response regulator NC_007622.3794948.p0 Protein 5e-36 43
MYA_5186 YP_006336265.1 two-component response regulator NC_003923.1003417.p0 Protein 5e-36 43
MYA_5186 YP_006336265.1 two-component response regulator NC_013450.8614146.p0 Protein 5e-36 43
MYA_5186 YP_006336265.1 two-component response regulator NC_002951.3238224.p0 Protein 5e-36 43
MYA_5186 YP_006336265.1 two-component response regulator NC_007793.3914065.p0 Protein 5e-36 43
MYA_5186 YP_006336265.1 two-component response regulator NC_002758.1121390.p0 Protein 5e-36 43
MYA_5186 YP_006336265.1 two-component response regulator NC_010079.5776364.p0 Protein 5e-36 43
MYA_5186 YP_006336265.1 two-component response regulator NC_002952.2859858.p0 Protein 5e-36 43
MYA_5186 YP_006336265.1 two-component response regulator AF155139.2.orf0.gene Protein 3e-42 43
MYA_5186 YP_006336265.1 two-component response regulator HE999704.1.gene1528. Protein 1e-33 43
MYA_5186 YP_006336265.1 two-component response regulator AE015929.1.gene1106. Protein 2e-30 42
MYA_5186 YP_006336265.1 two-component response regulator HE999704.1.gene2815. Protein 1e-40 42
MYA_5186 YP_006336265.1 two-component response regulator NC_002695.1.916589.p Protein 3e-32 42
MYA_5186 YP_006336265.1 two-component response regulator CP001138.1.gene2239. Protein 3e-31 42
MYA_5186 YP_006336265.1 two-component response regulator CP001918.1.gene3444. Protein 2e-31 42
MYA_5186 YP_006336265.1 two-component response regulator BAC0039 Protein 3e-32 42
MYA_5186 YP_006336265.1 two-component response regulator BAC0596 Protein 3e-31 42
MYA_5186 YP_006336265.1 two-component response regulator CP000034.1.gene2186. Protein 3e-32 42
MYA_5186 YP_006336265.1 two-component response regulator BAC0347 Protein 2e-34 41
MYA_5186 YP_006336265.1 two-component response regulator BAC0111 Protein 2e-36 41
MYA_5186 YP_006336265.1 two-component response regulator FJ349556.1.orf0.gene Protein 2e-38 41
MYA_5186 YP_006336265.1 two-component response regulator AE016830.1.gene1681. Protein 2e-42 41
MYA_5186 YP_006336265.1 two-component response regulator NC_012469.1.7686381. Protein 8e-39 41
MYA_5186 YP_006336265.1 two-component response regulator CP000647.1.gene2531. Protein 9e-30 41
MYA_5186 YP_006336265.1 two-component response regulator CP001918.1.gene5135. Protein 5e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MYA_5186 YP_006336265.1 two-component response regulator VFG1563 Protein 4e-72 62
MYA_5186 YP_006336265.1 two-component response regulator VFG1702 Protein 3e-72 62
MYA_5186 YP_006336265.1 two-component response regulator VFG1389 Protein 3e-31 46