Gene Information

Name : MYA_5065 (MYA_5065)
Accession : YP_006336144.1
Strain :
Genome accession: NC_017921
Putative virulence/resistance : Virulence
Product : Winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2349785 - 2350447 bp
Length : 663 bp
Strand : +
Note : -

DNA sequence :
ATGCGCGTACTGCTCGTCGAGGACGATCCGCTGATCGGCAGCGGGCTCGAACAGGGCCTCAGACAGGAAGGCTTCGCGGT
CGACTGGGTGAAGGACGGCGACGCCGCGTCGCTCGCGCTGCGCTCGACCGGCTACGGGCTGCTGCTGCTCGACCTCGGGC
TGCCGAACCGCGACGGTCTGTCGGTGCTCGCGGCACTGCGCCGCCGCGACGAAACGCTGCCCGCGATCATCATCACCGCG
CGCGACGGCGTGCCGGACCGCATCGCCGGCCTCGACAGCGGCGCCGACGACTACCTCGTCAAGCCGTTCGTGCTCGAGGA
GCTGCTCGCGCGCATTCGCGCGGTCACGCGGCGTCACGCCGGGCGCGCGCAGACGACGCTCGCGATCGGCCCGCTGCGGC
TCGATCCGATCAAGCATCTGGTGTGGCTCAACGACGACGAAGTTACGCTGTCGCCGAAGGAGTTCGTGCTGCTGCACGAA
CTGATGCGCGACCCCGGCGCGGTGATCTCGCGCGAACAGTTCGAGGAACGGCTGTACAGCTGGGGCGAAGAGATCGAGAG
CAACGCGGTGCAGGTTCACATCCACAACCTGCGCAAGAAGCTCGGTCATGACATGATCCGCACGGTGCGCGGCGTCGGCT
ACCGGATCGGTGACAGCGCATGA

Protein sequence :
MRVLLVEDDPLIGSGLEQGLRQEGFAVDWVKDGDAASLALRSTGYGLLLLDLGLPNRDGLSVLAALRRRDETLPAIIITA
RDGVPDRIAGLDSGADDYLVKPFVLEELLARIRAVTRRHAGRAQTTLAIGPLRLDPIKHLVWLNDDEVTLSPKEFVLLHE
LMRDPGAVISREQFEERLYSWGEEIESNAVQVHIHNLRKKLGHDMIRTVRGVGYRIGDSA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-37 49
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MYA_5065 YP_006336144.1 Winged helix family two component transcriptional regulator BAC0487 Protein 8e-32 45
MYA_5065 YP_006336144.1 Winged helix family two component transcriptional regulator BAC0083 Protein 8e-29 42
MYA_5065 YP_006336144.1 Winged helix family two component transcriptional regulator BAC0197 Protein 3e-27 42
MYA_5065 YP_006336144.1 Winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-22 41
MYA_5065 YP_006336144.1 Winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-22 41
MYA_5065 YP_006336144.1 Winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-22 41
MYA_5065 YP_006336144.1 Winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-22 41
MYA_5065 YP_006336144.1 Winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-22 41
MYA_5065 YP_006336144.1 Winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-22 41
MYA_5065 YP_006336144.1 Winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-22 41
MYA_5065 YP_006336144.1 Winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MYA_5065 YP_006336144.1 Winged helix family two component transcriptional regulator VFG0473 Protein 7e-40 49
MYA_5065 YP_006336144.1 Winged helix family two component transcriptional regulator VFG1389 Protein 1e-26 42
MYA_5065 YP_006336144.1 Winged helix family two component transcriptional regulator VFG0596 Protein 5e-24 41