Gene Information

Name : soxS (EBL_c36440)
Accession : YP_006321206.1
Strain : Escherichia blattae DSM 4481
Genome accession: NC_017910
Putative virulence/resistance : Resistance
Product : regulatory protein of superoxide response regulon
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3767082 - 3767405 bp
Length : 324 bp
Strand : +
Note : -

DNA sequence :
ATGGCACATCAGGAAATTATCGCGACCCTGATCCAGTGGATCGATGAGCATATTGACCAGCCGCTGAATATCGATATGGT
GGCGAAAAAATCCGGTTATTCAAAATGGTACTTGCAGCGAATGTTCCGCTCGGTCACGCGCCAGGCGCTGGGGGAGTACA
TTCGCCTGCGCCGCCTGGCCCTGGCGGCAGAAGCCCTGCGTACCACCCAGAAACCCATTTTTGATATCGCTATGGACCAC
GGTTATATCTCTCAGCAGACCTTTTCCCGGGTCTTCCGCCGTGAATACGCCCGCACCCCTACCGATTATCGCCAGCACGT
CTGA

Protein sequence :
MAHQEIIATLIQWIDEHIDQPLNIDMVAKKSGYSKWYLQRMFRSVTRQALGEYIRLRRLALAAEALRTTQKPIFDIAMDH
GYISQQTFSRVFRREYARTPTDYRQHV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 3e-34 80
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 9e-16 46
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 9e-16 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_006321206.1 regulatory protein of superoxide response regulon CP001138.1.gene4488. Protein 8e-35 80
soxS YP_006321206.1 regulatory protein of superoxide response regulon CP001918.1.gene327.p Protein 9e-35 80
soxS YP_006321206.1 regulatory protein of superoxide response regulon CP000647.1.gene4499. Protein 6e-35 80
soxS YP_006321206.1 regulatory protein of superoxide response regulon NC_002695.1.914293.p Protein 9e-34 77
soxS YP_006321206.1 regulatory protein of superoxide response regulon BAC0371 Protein 9e-34 77
soxS YP_006321206.1 regulatory protein of superoxide response regulon CP000034.1.gene4505. Protein 2e-33 76
soxS YP_006321206.1 regulatory protein of superoxide response regulon CP001138.1.gene612.p Protein 1e-18 46
soxS YP_006321206.1 regulatory protein of superoxide response regulon NC_010558.1.6276025. Protein 4e-16 46
soxS YP_006321206.1 regulatory protein of superoxide response regulon CP000647.1.gene1624. Protein 1e-15 41
soxS YP_006321206.1 regulatory protein of superoxide response regulon CP001918.1.gene2033. Protein 9e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_006321206.1 regulatory protein of superoxide response regulon VFG0585 Protein 7e-35 80
soxS YP_006321206.1 regulatory protein of superoxide response regulon VFG1038 Protein 4e-16 46