Gene Information

Name : EBL_c16690 (EBL_c16690)
Accession : YP_006319274.1
Strain : Escherichia blattae DSM 4481
Genome accession: NC_017910
Putative virulence/resistance : Resistance
Product : putative regulatory protein AraC family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1741094 - 1741459 bp
Length : 366 bp
Strand : -
Note : -

DNA sequence :
ATGGATATCCCTGCACAGGTCATTGAAGAGCTGCTGGTCTGGATAGACAAAAATCTGGATAAGCCCCTGAGGATTGACGA
CGTCGCCCGTTATGCTGGTTACTCGAAATGGCACCTGCAACGCATGTTTGTTAACCACACCGGCCATAATCTGGCCCGCT
ATATTCGCGAACGTAAGCTACACCTGGCGGCGCGGGATCTCTGCACAACCAGCGAAACGGTGTATCAGATCTGCTCACGC
TACGGTTTTGAATCCCAGCAATCATTTACGCGGATTTTCACTAAAACATTCAGCCAGCCGCCGGGAATGTACCGCAAAAA
CTGCCCCTTCGGTCGGGCCCGCCCCGGTGCCGGGCAGGCCGCCTGA

Protein sequence :
MDIPAQVIEELLVWIDKNLDKPLRIDDVARYAGYSKWHLQRMFVNHTGHNLARYIRERKLHLAARDLCTTSETVYQICSR
YGFESQQSFTRIFTKTFSQPPGMYRKNCPFGRARPGAGQAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 7e-20 49
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 7e-20 49
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-21 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EBL_c16690 YP_006319274.1 putative regulatory protein AraC family CP001138.1.gene612.p Protein 6e-35 66
EBL_c16690 YP_006319274.1 putative regulatory protein AraC family NC_010558.1.6276025. Protein 3e-20 49
EBL_c16690 YP_006319274.1 putative regulatory protein AraC family CP001138.1.gene4488. Protein 7e-22 48
EBL_c16690 YP_006319274.1 putative regulatory protein AraC family CP000647.1.gene1624. Protein 1e-22 48
EBL_c16690 YP_006319274.1 putative regulatory protein AraC family BAC0371 Protein 4e-22 47
EBL_c16690 YP_006319274.1 putative regulatory protein AraC family NC_002695.1.914293.p Protein 4e-22 47
EBL_c16690 YP_006319274.1 putative regulatory protein AraC family CP001918.1.gene2033. Protein 2e-22 47
EBL_c16690 YP_006319274.1 putative regulatory protein AraC family CP000647.1.gene4499. Protein 1e-21 46
EBL_c16690 YP_006319274.1 putative regulatory protein AraC family CP001918.1.gene327.p Protein 2e-21 46
EBL_c16690 YP_006319274.1 putative regulatory protein AraC family CP000034.1.gene4505. Protein 9e-22 46
EBL_c16690 YP_006319274.1 putative regulatory protein AraC family NC_002695.1.917339.p Protein 2e-22 46
EBL_c16690 YP_006319274.1 putative regulatory protein AraC family CP001138.1.gene1637. Protein 2e-22 46
EBL_c16690 YP_006319274.1 putative regulatory protein AraC family BAC0560 Protein 2e-22 46
EBL_c16690 YP_006319274.1 putative regulatory protein AraC family CP000034.1.gene1596. Protein 1e-22 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EBL_c16690 YP_006319274.1 putative regulatory protein AraC family VFG1038 Protein 3e-20 49
EBL_c16690 YP_006319274.1 putative regulatory protein AraC family VFG0585 Protein 6e-22 48