Gene Information

Name : ABTJ_01327 (ABTJ_01327)
Accession : YP_006289233.1
Strain : Acinetobacter baumannii MDR-TJ
Genome accession: NC_017847
Putative virulence/resistance : Resistance
Product : nucleotidyltransferase family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1379371 - 1380150 bp
Length : 780 bp
Strand : +
Note : PFAM: Nucleotidyltransferase domain

DNA sequence :
GTGATCGCCGAAGTATCGACTCAACTATCAGAGGTAGTTGGCGTCATCGAGCGCCATCTCGAACCGACGTTGCTGGCCGT
ACATTTGTACGGCTCCGCAGTGGATGGCGGCCTGAAGCCACACAGTGATATTGATTTGCTGGTTACGGTGACCGTAAGGC
TTGATGAAACAACGCGGCGAGCTTTGATCAACGACCTTTTGGAAACTTCGGCTTCCCCTGGAGAGAGCGAGATTCTCCGC
GCTGTAGAAGTCACCATTGTTGTGCACGACGACATCATTCCGTGGCGTTATCCAGCTAAGCGCGAACTGCAATTTGGAGA
ATGGCAGCGCAATGACATTCTTGCAGGTATCTTCGAGCCAGCCACGATCGACATTGATCTGGCTATCTTGCTGACAAAAG
CAAGAGAACATAGCGTTGCCTTGGTAGGTCCAGCGGCGGAGGAACTCTTTGATCCGGTTCCTGAACAGGATCTATTTGAG
GCGCTAAATGAAACCTTAACGCTATGGAACTCGCCGCCCGACTGGGCTGGCGATGAGCGAAATGTAGTGCTTACGTTGTC
CCGCATTTGGTACAGCGCAGTAACCGGCAAAATCGCGCCGAAGGATGTCGCTGCCGACTGGGCAATGGAGCGCCTGCCGG
CCCAGTATCAGCCCGTCATACTTGAAGCTAGACAGGCTTATCTTGGACAAGAAGAAGATCGCTTGGCCTCCCGCGCAGAT
CAGTTGGAAGAATTTGTTCACTACGTGAAAGGCGAGATCACCAAGGTAGTCGGCAAATAA

Protein sequence :
MIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPHSDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILR
AVEVTIVVHDDIIPWRYPAKRELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLFE
ALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQPVILEARQAYLGQEEDRLASRAD
QLEEFVHYVKGEITKVVGK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aadA1 ACV89835.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR7 Protein 3e-116 99
aadA1 YP_006098376.1 aminoglycoside adenylyltransferase Not tested Tn2411 Protein 4e-116 99
unnamed AFV53113.1 AadA1 aminoglycoside (3') adenyltransferase Not tested AbGRI2-1 Protein 3e-116 99
aadA1 ACN81025.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR5 Protein 4e-116 99
aadA1 AGK36646.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR26 Protein 3e-116 99
aadA1 ACY75515.1 aminoglycoside adenyltransferase Not tested Tn6060 Protein 4e-116 99
aadA1 CAD92142.1 aminoglycoside adenyltransferase Not tested Not named Protein 4e-116 99
aadA1 YP_005797133.1 aminoglycoside 3'-adenyltransferase Not tested AbaR4e Protein 4e-116 99
aadDA1 CAJ77087.1 Aminoglycoside 3-adenylyltransferase Not tested AbaR1 Protein 3e-116 99
aadA1 YP_005797149.1 aminoglycoside 3'-adenyltransferase Not tested AbaR4e Protein 4e-116 99
aadA1 CAJ77048.1 Aminoglycoside adenylyltransferase Not tested AbaR1 Protein 9e-117 99
aadA1 AAL08435.1 streptomycin adenyltransferase AadA1 Not tested SRL Protein 5e-110 96
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein Not tested ICEPmu1 Protein 1e-108 93
aadA2 ACF06158.1 aminoglycoside 3''-adenyltransferase Not tested Tn5036-like Protein 4e-104 88
aadA2 AAK02046.1 streptomycin/spectinomycin resistance protein Not tested SGI1 Protein 4e-104 88
aadA2 AGF35027.1 AadA2 aminoglycoside adenylyltransferase Not tested SGI1 Protein 4e-104 88
aadA7 AGK07073.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 4e-90 73
aadA7 AAR21854.1 aminoglycoside (3'')(9) adenylyltransferase; AAD(3'')(9) Not tested SGI1 Protein 4e-90 73
aadA7 AAT37846.1 aminoglycoside adenyltransferase Not tested Class I integron Protein 4e-90 73
aadA7 AGF35062.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 4e-90 73
aadA7 AGK06932.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 4e-90 73
aadA7 AGK06969.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 4e-90 73
aadA7 AGK07015.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 4e-90 73

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein AM932669.1.gene3.p01 Protein 5e-117 100
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein AJ704863.gene12.p01 Protein 1e-106 99
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein AJ584652.2.gene7.p01 Protein 9e-115 99
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein JN596991.2.gene3.p01 Protein 3e-116 99
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein FR748153.1.gene5.p01 Protein 3e-116 99
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein AY123251.gene3.p01 Protein 2e-116 99
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein NC_010410.6003168.p0 Protein 2e-116 99
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein Y18050.2.gene6.p01 Protein 3e-116 99
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein AF313471.1.gene3.p01 Protein 2e-116 99
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein AY339625.2.gene17.p0 Protein 2e-116 99
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein AJ628353.gene.p01 Protein 1e-86 99
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein NC_010410.6003170.p0 Protein 5e-117 99
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein AF047479.2.orf1.gene Protein 6e-106 89
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein EU118119.1.orf1.gene Protein 2e-104 88
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein AF174129.3.gene3.p01 Protein 2e-104 87
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein AF294653.1.gene3.p01 Protein 7e-105 87
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein AY263741.gene.p01 Protein 2e-102 86
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein U37105.2.gene4.p01 Protein 2e-93 76
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein AY139598.1.gene2.p01 Protein 1e-72 58
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein NC_010558.1.6275994. Protein 3e-73 58
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein DQ865198.gene.p01 Protein 3e-73 58
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein NC_003198.gene.p01 Protein 9e-50 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ABTJ_01327 YP_006289233.1 nucleotidyltransferase family protein VFG1026 Protein 3e-110 96