
|
Name : W5S_0465 (W5S_0465) Accession : YP_006281463.1 Strain : Pectobacterium sp. SCC3193 Genome accession: NC_017845 Putative virulence/resistance : Virulence Product : Phage transcriptional regulator, AlpA Function : - COG functional category : - COG ID : - EC number : - Position : 503542 - 503742 bp Length : 201 bp Strand : - Note : - DNA sequence : ATGACGGATATCACGTTGATTCGTTTATCGGGTGTGATGAAAAAAACCGGCCTCAGGAAATCATGGATTTACCTGCTGAT GAAGCAGGGGGAATTTCCTCAGACGGTCAAAATCGGCGCCCGCTCGGTAGCGTGGGTGGAAAGTGAGGTGAATGACTGGA TCGCGGCACGTATCAGCCAGCGCGGGGAGGTTAAACCATGA Protein sequence : MTDITLIRLSGVMKKTGLRKSWIYLLMKQGEFPQTVKIGARSVAWVESEVNDWIAARISQRGEVKP |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 3e-13 | 55 |
| unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 4e-13 | 55 |
| PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 8e-11 | 50 |
| VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-10 | 49 |
| VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-10 | 49 |
| VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-10 | 49 |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 1e-11 | 47 |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-11 | 47 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-11 | 47 |
| VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 3e-09 | 45 |
| rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 6e-08 | 42 |
| SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 9e-08 | 42 |
| S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 9e-08 | 42 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| W5S_0465 | YP_006281463.1 | Phage transcriptional regulator, AlpA | VFG1118 | Protein | 8e-11 | 49 |
| W5S_0465 | YP_006281463.1 | Phage transcriptional regulator, AlpA | VFG1141 | Protein | 5e-12 | 47 |
| W5S_0465 | YP_006281463.1 | Phage transcriptional regulator, AlpA | VFG0651 | Protein | 3e-08 | 42 |