Gene Information

Name : W5S_0465 (W5S_0465)
Accession : YP_006281463.1
Strain : Pectobacterium sp. SCC3193
Genome accession: NC_017845
Putative virulence/resistance : Virulence
Product : Phage transcriptional regulator, AlpA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 503542 - 503742 bp
Length : 201 bp
Strand : -
Note : -

DNA sequence :
ATGACGGATATCACGTTGATTCGTTTATCGGGTGTGATGAAAAAAACCGGCCTCAGGAAATCATGGATTTACCTGCTGAT
GAAGCAGGGGGAATTTCCTCAGACGGTCAAAATCGGCGCCCGCTCGGTAGCGTGGGTGGAAAGTGAGGTGAATGACTGGA
TCGCGGCACGTATCAGCCAGCGCGGGGAGGTTAAACCATGA

Protein sequence :
MTDITLIRLSGVMKKTGLRKSWIYLLMKQGEFPQTVKIGARSVAWVESEVNDWIAARISQRGEVKP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAA21398.1 - Not tested HPI Protein 4e-13 55
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 3e-13 55
PMI2608 YP_002152324.1 prophage regulatory protein Not tested Not named Protein 8e-11 50
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 2e-10 49
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 3e-10 49
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 3e-10 49
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 2e-11 47
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 1e-11 47
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 2e-11 47
VC0497 NP_230151.1 transcriptional regulator Not tested VSP-2 Protein 3e-09 45
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 9e-08 42
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 6e-08 42
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 9e-08 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
W5S_0465 YP_006281463.1 Phage transcriptional regulator, AlpA VFG1118 Protein 8e-11 49
W5S_0465 YP_006281463.1 Phage transcriptional regulator, AlpA VFG1141 Protein 5e-12 47
W5S_0465 YP_006281463.1 Phage transcriptional regulator, AlpA VFG0651 Protein 3e-08 42