Gene Information

Name : W5S_3838 (W5S_3838)
Accession : YP_006284773.1
Strain : Pectobacterium sp. SCC3193
Genome accession: NC_017845
Putative virulence/resistance : Resistance
Product : Tellurium resistance protein, TerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4131225 - 4131803 bp
Length : 579 bp
Strand : +
Note : -

DNA sequence :
ATGAGCGTTTCTCTTTCTAAAGGCGGTAATGTCTCACTGAGCAAAGCAGCACCGACGATGAAAAATGTCTTAGTCGGTCT
TGGCTGGGATGCACGCGCGACGGATGGTCAGGACTTTGACCTGGATGCGTCAGCATTCCTGCTCAATGCGAATGGCAAAG
TCCGTGGTGATACCGACTTCATTTTCTACAATAACTTGAAGTCTGCTGATGGCTCAGTGGCCCACACCGGCGATAACCGT
ACAGGCGCGGGTGATGGAGATGACGAATCATTGAAAATTAAGCTGGATCTGATTCCGGCTGAGGTCGACAAAATCGTTTT
CGTTGTCACTATCCATGATGCACAGGTCCGTAACCAGAGCTTTGGTCAGGTATCCGGCGCGTTCATTCGCTTGGTAAACG
ATGACACCCAAGCCGAGATCGCACGCTACGACCTGACTGAAGATGCTTCCACTGAAACCGCCATGCTGTTCGGTGAACTG
TATCGTCATAATACGGAGTGGAAATTCCGTGCCGTCGGTCAGGGCTATGCAGGTGGTTTGGCATCGGTCTGCTCACAATA
CGGTATCAACGCATCCTGA

Protein sequence :
MSVSLSKGGNVSLSKAAPTMKNVLVGLGWDARATDGQDFDLDASAFLLNANGKVRGDTDFIFYNNLKSADGSVAHTGDNR
TGAGDGDDESLKIKLDLIPAEVDKIVFVVTIHDAQVRNQSFGQVSGAFIRLVNDDTQAEIARYDLTEDASTETAMLFGEL
YRHNTEWKFRAVGQGYAGGLASVCSQYGINAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-79 90
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-80 90
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-80 90
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-66 70
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-58 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-58 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-58 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-57 64
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
W5S_3838 YP_006284773.1 Tellurium resistance protein, TerD BAC0389 Protein 2e-79 90
W5S_3838 YP_006284773.1 Tellurium resistance protein, TerD BAC0390 Protein 2e-62 67