Gene Information

Name : ACPL_2205 (ACPL_2205)
Accession : YP_006265170.1
Strain : Actinoplanes sp. SE50/110
Genome accession: NC_017803
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2369677 - 2370369 bp
Length : 693 bp
Strand : +
Note : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence : 
ATGCTGCACGCCATGCGCCTGCTGGTGATCGAGGACGAGCCCGAGTTGGCGACCATCCTGCAACGGGGACTGACGGCCGA
GGGGTACACCGTCGACGTCGCCGGTGACGGACGGGTCGCGCTGGACCTGGCCCGCTTCGAGGACTACGCGGGCATCGTGC
TCGACCTGATGCTGCCGGGACTCAACGGCTACCGTGTCTGCGCGACGTTGCGCCGTGAGGGGATCCGCACCCCGATCCTG
GTGCTGACCGCGAAGGACGGCGACTACGACCAGATCGAGGCGCTCGACACCGGTGCCGACGACTTCCTGAGCAAACCGTT
CTCCTACCCGGTGCTGGTCGCCCGGCTGCGGGCGCTGGTGCGCCGCGGTCCGGCCGCCGTCCCGGTCCGGCTCACCGTCG
GCGACCTCGTCCTGGAACGGGCCGCGCGGACCTGCCGGCGCGGTACGGTGCCGATCACCTTGACCCCCCGCGAGTTCGCG
ATCCTGGACCTCCTCGCGCACCGTGCGGGCGAGCCGGTCACCAAACTGGAGATCCTGCGTCAGGTCTGGCCCGAGGACGT
GGACGACCCGAACCTGGTCGAGGTGCGCGTCGGCCGGCTCCGCCGCAAGATCGATCTGCCCTTCGGGCGCAGCAGCCTGC
GTACGGTGCGGGGCACCGGTTACCGCCTCGTCGACGACCGGGCGGCGGCATGA

Protein sequence : 
MLHAMRLLVIEDEPELATILQRGLTAEGYTVDVAGDGRVALDLARFEDYAGIVLDLMLPGLNGYRVCATLRREGIRTPIL
VLTAKDGDYDQIEALDTGADDFLSKPFSYPVLVARLRALVRRGPAAVPVRLTVGDLVLERAARTCRRGTVPITLTPREFA
ILDLLAHRAGEPVTKLEILRQVWPEDVDDPNLVEVRVGRLRRKIDLPFGRSSLRTVRGTGYRLVDDRAAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-31 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ACPL_2205 YP_006265170.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-29 44
ACPL_2205 YP_006265170.1 winged helix family two component transcriptional regulator BAC0125 Protein 5e-33 43
ACPL_2205 YP_006265170.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-29 43
ACPL_2205 YP_006265170.1 winged helix family two component transcriptional regulator BAC0308 Protein 5e-31 42
ACPL_2205 YP_006265170.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-22 42
ACPL_2205 YP_006265170.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-26 41
ACPL_2205 YP_006265170.1 winged helix family two component transcriptional regulator BAC0111 Protein 7e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ACPL_2205 YP_006265170.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-31 41
ACPL_2205 YP_006265170.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-26 41