|
Name : DGo_PC0143 (DGo_PC0143) Accession : YP_006258799.1 Strain : Genome accession: NC_017771 Putative virulence/resistance : Virulence Product : Transcriptional regulator with ATPase activity Function : - COG functional category : - COG ID : - EC number : - Position : 117845 - 118045 bp Length : 201 bp Strand : + Note : - DNA sequence : ATGAAAAACCGTATCAAGGTGCTGCGCGCCGAGAATGATCTGACGCAAGCGCAACTGGCCGATCAATTAGATGTATCCCG CCAGACCGTCAACGCCTTGGAAACCGGCAAATACGATCCGAGCCTACCGCTGGCCTTCAAACTGGCGCGGCTGTTTGGGC GTCGCATTGAGGACATCTTTCTGGACGGCGATAGCGAATGA Protein sequence : MKNRIKVLRAENDLTQAQLADQLDVSRQTVNALETGKYDPSLPLAFKLARLFGRRIEDIFLDGDSE |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SH2314 | YP_254229.1 | hypothetical protein | Not tested | ¥ðSh1 | Protein | 2e-12 | 52 |
| EF0524 | NP_814301.1 | Cro/CI family transcriptional regulator | Not tested | Not named | Protein | 5e-08 | 47 |
| ef0042 | AAM75247.1 | EF0042 | Virulence | Not named | Protein | 4e-08 | 47 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| DGo_PC0143 | YP_006258799.1 | Transcriptional regulator with ATPase activity | VFG2168 | Protein | 1e-08 | 47 |
| DGo_PC0143 | YP_006258799.1 | Transcriptional regulator with ATPase activity | VFG2175 | Protein | 1e-08 | 47 |
