Gene Information

Name : SHJG_4839 (SHJG_4839)
Accession : YP_006245981.1
Strain : Streptomyces hygroscopicus 5008
Genome accession: NC_017765
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5567570 - 5568145 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGCTGTAAGCCTGTCCAAGGGTGGCAACGTCTCGCTCACCAAGGAGGCTCCGGGCCTGACCGCCGTCACCGTGGGCCT
CGGCTGGGACGTCCGCACCACGACCGGCACCGACTTCGACCTGGACGCCTCCGCCATCGCGGTGAACCCCCAGGGCAGGG
TCTACTCGGACGCCCACTTCGTCTTCTTCAACAACAAGCAGACCCCGGACAACTCGATCGTCCACACGGGCGACAACCGC
ACGGGCGAGGGCGCCGGCGACGACGAGGCGATCAACGTCAACCTGGCCGCGCTCCCGGCCGACATCGAGAAGGTCGTCTT
CCCGGTCTCCATCTACGACGCCGAGAACCGCGGCCAGAACTTCGGCCAGGTCCGCAACGCCTACATCCGCATCGTCAACC
AGGCGGGCGGCGCCGAGATCGCGCGCTACGACCTGTCCGAGGACGCGGCCACCGAGACGGCCATGATCTTCGGCGAGCTG
TACCGCAACGGCGCGGAGTGGAAGTTCCGCGCGGTCGGTCAGGGCTACGCCTCCGGCCTGGTCGGCATCGCCCAGGACTT
CGGTGTGAACGTCTGA

Protein sequence :
MAVSLSKGGNVSLTKEAPGLTAVTVGLGWDVRTTTGTDFDLDASAIAVNPQGRVYSDAHFVFFNNKQTPDNSIVHTGDNR
TGEGAGDDEAINVNLAALPADIEKVVFPVSIYDAENRGQNFGQVRNAYIRIVNQAGGAEIARYDLSEDAATETAMIFGEL
YRNGAEWKFRAVGQGYASGLVGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-59 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-59 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-59 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-57 64
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-59 64
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-58 59
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-57 59
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-58 59
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-30 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SHJG_4839 YP_006245981.1 tellurium resistance protein BAC0390 Protein 8e-59 62
SHJG_4839 YP_006245981.1 tellurium resistance protein BAC0389 Protein 2e-57 59