Gene Information

Name : SHJG_3860 (SHJG_3860)
Accession : YP_006245005.1
Strain : Streptomyces hygroscopicus 5008
Genome accession: NC_017765
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4456515 - 4457093 bp
Length : 579 bp
Strand : -
Note : -

DNA sequence :
ATGGGTGTCACGCTCGCCAAGGGAGGCAACGTCTCCCTCTCCAAGGCCGCACCGAACCTCACCAACGTCATGATCGGACT
GGGCTGGGACGCCCGGTCCACCACCGGCGCCCCCTTCGACCTGGACGCCAGCGCGCTGCTGTGCGGGGCCGGCAACCGGG
TGCTGGGCGACGAGTGGTTCGTCTTCTACAACCAGCTCACCAGCCCCGACGGCTCCGTGGAGCATACCGGTGACAACCTC
ACCGGTGAGGGCGAGGGCGACGACGAGTCGCTCCTGGTGGACCTCGCGAAGGTGCCGCCGCAGTGCGAGAAGATCGTCTT
CCCCGTCTCCATCCACATGGCGGACGAGCGCGGGCAGACCTTCGGCCAGGTCTCCAACGCCTTCATCCGCGTCGTCAACC
AGGCCGACGGCCAGGAACTGGCCCGCTACGACCTCAGTGAGGACGCCTCCACCGAGACCGCCATGATCTTCGGCGAGCTC
TACCGCTACCAGGGCGAGTGGAAGTTCCGAGCGGTGGGTCAGGGGTACGCGTCGGGTCTGCGGGGCATCGCTCTAGACTT
CGGAGTCAACGTTTCGTAA

Protein sequence :
MGVTLAKGGNVSLSKAAPNLTNVMIGLGWDARSTTGAPFDLDASALLCGAGNRVLGDEWFVFYNQLTSPDGSVEHTGDNL
TGEGEGDDESLLVDLAKVPPQCEKIVFPVSIHMADERGQTFGQVSNAFIRVVNQADGQELARYDLSEDASTETAMIFGEL
YRYQGEWKFRAVGQGYASGLRGIALDFGVNVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-57 66
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 5e-57 66
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-57 66
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-59 64
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-53 61
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-53 61
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-53 61
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-54 60
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SHJG_3860 YP_006245005.1 tellurium resistance protein BAC0389 Protein 5e-56 65
SHJG_3860 YP_006245005.1 tellurium resistance protein BAC0390 Protein 1e-57 62