Gene Information

Name : MY9_0297 (MY9_0297)
Accession : YP_006230092.1
Strain : Bacillus sp. JS
Genome accession: NC_017743
Putative virulence/resistance : Resistance
Product : putative stress adaptation protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 307942 - 308520 bp
Length : 579 bp
Strand : +
Note : 'COGmatches:COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1; PfamMatches:PF02342.12'

DNA sequence :
ATGGCCATTCAATTATCAAAAGGACAGCGCATTGATTTAACAAAAACAAATCCGGGACTGACAAAAGCGGTGATCGGTTT
AGGCTGGGATACAAACAAGTACTCCGGCGGACACGATTTTGACCTGGATGCTTCGGCCTTTTTAGTTGATGCGCATGATA
ACTGCGTAAATGATCTCGATTTCGTCTTCTATAATAACCTTGAACACCCGAGCGGCGGTGTCATCCATACGGGTGACAAC
CGTACGGGTGAAGGCGACGGAGATGATGAGCAGATTATCGTGGATTTCTCAAAAATTCCTGCTCACATTGAGAAAATCGG
CATCACAGTGACCATTCACGATGCTGAAGCACGCAGCCAAAACTTCGGACAAGTTTCCAATGCGTTTGTGCGTGTTGTGG
ACGAAGAGACGCAGAATGAGCTTATTCGCTTCGATTTGGGAGAAGACTTCTCCATAGAAACAGCTGTTGTCGTTTGTGAG
CTATACAGACACGGCGGCGAGTGGAAATTCAATGCGATCGGCAGCGGTTTTTCCGGCGGGCTGGCTGCATTGTGCCGGAA
TTATGGTTTGCAAGTGTAA

Protein sequence :
MAIQLSKGQRIDLTKTNPGLTKAVIGLGWDTNKYSGGHDFDLDASAFLVDAHDNCVNDLDFVFYNNLEHPSGGVIHTGDN
RTGEGDGDDEQIIVDFSKIPAHIEKIGITVTIHDAEARSQNFGQVSNAFVRVVDEETQNELIRFDLGEDFSIETAVVVCE
LYRHGGEWKFNAIGSGFSGGLAALCRNYGLQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-53 57
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-47 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-47 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-47 54
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 9e-52 53
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-52 53
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-52 53
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-45 50
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MY9_0297 YP_006230092.1 putative stress adaptation protein BAC0390 Protein 1e-51 55
MY9_0297 YP_006230092.1 putative stress adaptation protein BAC0389 Protein 3e-52 54