Gene Information

Name : MY9_0296 (MY9_0296)
Accession : YP_006230091.1
Strain : Bacillus sp. JS
Genome accession: NC_017743
Putative virulence/resistance : Resistance
Product : putative stress adaptation protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 307326 - 307907 bp
Length : 582 bp
Strand : +
Note : 'COGmatches:COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1; PfamMatches:PF02342.12'

DNA sequence :
ATGACAATTTCATTGGCAAAAGGACAAAAAGTAGATTTAACAAAAACAAATCCGGGTCTTTCAAAGGTTGTTGTCGGTTT
GGGCTGGGATACGAACAAGTATGACGGCGGACACGACTTTGATCTTGACTCAAGTGTGTTTCTGTTAGACGCTGCAGGCA
AATGCGCGTCACCAAACGACTTTATTTTCTATAACCAACTTGAAGGCGGCAACGGTTCAGTCGTTCATTCAGGCGACAAC
CTGACTGGTGCTGGCGAAGGCGACGATGAGAATGTAAAAGTAAATCTCAGCGCTGTACCGGCAAACATTGATAAAATCTC
ATTTGTTATTACCATTCACGAAGCAGAAGCGCGCAGCCAAAACTTTGGACAAGTTTCAAACGCGTTCGTCCGCATCGTAA
ATGAAGAAACAAATGAAGAGCTCATCCGTTACGATCTTGCAGAAGATTTCTCTATTGAAACGGCAATCATTGCAGGGGAG
CTTTACAGACATAACGGCGAGTGGAAATTCTCCGCAATCGGCTCAGGCTACCAAGGCGGCCTTGCCCGCATTGCAACAGA
CTACGGTTTGCAAGTCGGTTAA

Protein sequence :
MTISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSSVFLLDAAGKCASPNDFIFYNQLEGGNGSVVHSGDN
LTGAGEGDDENVKVNLSAVPANIDKISFVITIHEAEARSQNFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGE
LYRHNGEWKFSAIGSGYQGGLARIATDYGLQVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-50 58
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-49 57
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-49 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-49 57
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-40 51
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-40 51
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-41 51
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-41 51
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MY9_0296 YP_006230091.1 putative stress adaptation protein BAC0389 Protein 1e-49 58
MY9_0296 YP_006230091.1 putative stress adaptation protein BAC0390 Protein 2e-44 53
MY9_0296 YP_006230091.1 putative stress adaptation protein BAC0392 Protein 5e-25 41