Gene Information

Name : S70_07175 (S70_07175)
Accession : YP_006215997.1
Strain : Providencia stuartii MRSN 2154
Genome accession: NC_017731
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1502614 - 1503189 bp
Length : 576 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCAGTTTCCCTCGTTAAAGGTGGTAATGTATCCCTGACTAAAGAAGCACCGACAATGAATGTTGCTATGGTCGGTCT
GGGATGGGATGCTCGTGTTACTGACGGCGCAGATTTTGATTTAGATGCTTCTGTATTTATGGTTGGAGAAGACGGTAAAG
TTCTCTCTGATGCAAATTTTATCTTCTTCAACAACAAAGTAAGCCCATGTGGTTCTGTTGAACACCAAGGCGATAACCGT
ACTGGGGAAGGCGACGGTGATGACGAACAAGTCAAAATCGACCTGACTAAAGTTCCTGCTGAAGTGAAAAAACTGGTTTT
CTCTGTCACGATTTATGATGCAGAAACACGTAAACAAAACTTTGGCATGGTAAGCAACAGCTTTATGCGTGTTTACAACA
ACGATACCAATGCTGAAATTGCACGTTTTGACCTATCTGAAGACGCGTCAACTGAAACAGCAATGATTTTTGGTGAGCTA
TATCGCCATGGTAACGAGTGGAAATTCAAAGCGGTAGGCCAAGGCTTCGCGGGTGGCTTGAGTGCATTGGCAGCTCAACA
CGGTGTCAATATCTAA

Protein sequence :
MAVSLVKGGNVSLTKEAPTMNVAMVGLGWDARVTDGADFDLDASVFMVGEDGKVLSDANFIFFNNKVSPCGSVEHQGDNR
TGEGDGDDEQVKIDLTKVPAEVKKLVFSVTIYDAETRKQNFGMVSNSFMRVYNNDTNAEIARFDLSEDASTETAMIFGEL
YRHGNEWKFKAVGQGFAGGLSALAAQHGVNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-78 91
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-78 91
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-79 91
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-64 71
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-59 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 8e-59 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-59 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-59 64

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
S70_07175 YP_006215997.1 stress protein BAC0390 Protein 3e-76 84
S70_07175 YP_006215997.1 stress protein BAC0389 Protein 5e-58 64