Gene Information

Name : S70_07170 (S70_07170)
Accession : YP_006215996.1
Strain : Providencia stuartii MRSN 2154
Genome accession: NC_017731
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1501963 - 1502541 bp
Length : 579 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGAGCGTTTCTCTATCTAAAGGCGGCAATGTTTCGTTAAGCAAAGCAGCACCAACGATGAAAAACGTCCTAGTTGGACT
TGGCTGGGATGCTCGTTCAACAGACGGTCAGGACTTTGACTTAGATGCTTCTGCGTTTTTATTAGCCGCTAACGGAAAAG
TACGTGGTGATGCAGACTTTATTTTCTATAACAACCTAGCATCTGCCGACGGCTCAGTAACTCATACCGGTGATAACCGT
ACTGGTGAAGGCGATGGTGACGATGAAGCGCTGAAAATCAAATTAGACCTGATCCCAGCGGACATCGATAAAATCATCTT
CGTTGTCACTATTCATGATGCACAAGCTCGTCGCCAAAGTTTCGGCCAAGTTTCTGGTGCATTTATCCGTTTAGTCAATG
ATGACAACCAAATTGAAGTCGCTCGTTATGACCTGACTGAAGACGCGTCAACGGAAACGGCAATGCTATTCGGTGAATTA
TACCGTCATAGCAATGAGTGGAAATTCCGTGCCGTCGGTCAAGGCTATGCAGGTGGCCTAGCCTCTGTATGCGCTCAATA
CGGCATCAATGCATCTTGA

Protein sequence :
MSVSLSKGGNVSLSKAAPTMKNVLVGLGWDARSTDGQDFDLDASAFLLAANGKVRGDADFIFYNNLASADGSVTHTGDNR
TGEGDGDDEALKIKLDLIPADIDKIIFVVTIHDAQARRQSFGQVSGAFIRLVNDDNQIEVARYDLTEDASTETAMLFGEL
YRHSNEWKFRAVGQGYAGGLASVCAQYGINAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-73 93
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-74 93
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-74 93
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-58 70
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-54 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-54 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-54 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-52 63

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
S70_07170 YP_006215996.1 tellurium resistance protein BAC0389 Protein 6e-73 94
S70_07170 YP_006215996.1 tellurium resistance protein BAC0390 Protein 2e-56 67