Name : S70_06270 (S70_06270) Accession : YP_006215816.1 Strain : Providencia stuartii MRSN 2154 Genome accession: NC_017731 Putative virulence/resistance : Virulence Product : phage regulatory protein Function : - COG functional category : - COG ID : - EC number : - Position : 1302842 - 1303084 bp Length : 243 bp Strand : - Note : COG3311 Predicted transcriptional regulator DNA sequence : ATGACGATGATTCAAACAACCCCAACCACCAGCCTGCTGAATGACCAGTTCGTTGATATGAAATTTATCACTCAGTTTAC CGGGCTTACGGATAAATGGTTCTACAAGCTCATACAGGACGGTGAGTTTCCCAAACCGATTAAACTGGGACGCAGCTCAA GATGGCTGAAAAGCGAGGTTGAACAGTGGCTACAAGCGCGCATTGATGAATCGAGAGAGGGCAACTCCGCCCTTGGATCC TAA Protein sequence : MTMIQTTPTTSLLNDQFVDMKFITQFTGLTDKWFYKLIQDGEFPKPIKLGRSSRWLKSEVEQWLQARIDESREGNSALGS |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 2e-21 | 79 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 9e-21 | 76 |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 6e-21 | 76 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 6e-21 | 76 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 9e-21 | 76 |
unnamed | CAI43835.1 | hypothetical protein | Not tested | LEE | Protein | 4e-21 | 74 |
unnamed | ADD91712.1 | putative transcriptional regulator AlpA | Not tested | PAI-I AL862 | Protein | 4e-21 | 74 |
unnamed | AAL08466.1 | unknown | Not tested | SRL | Protein | 5e-21 | 73 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 4e-16 | 65 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 4e-16 | 65 |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 9e-21 | 64 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 1e-20 | 64 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
S70_06270 | YP_006215816.1 | phage regulatory protein | VFG0651 | Protein | 2e-21 | 76 |
S70_06270 | YP_006215816.1 | phage regulatory protein | VFG1057 | Protein | 2e-21 | 73 |
S70_06270 | YP_006215816.1 | phage regulatory protein | VFG1480 | Protein | 3e-21 | 64 |