Gene Information

Name : H9401_4612 (H9401_4612)
Accession : YP_006211666.1
Strain : Bacillus anthracis H9401
Genome accession: NC_017729
Putative virulence/resistance : Resistance
Product : Alkaline phosphatase synthesis response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4387504 - 4388223 bp
Length : 720 bp
Strand : -
Note : -

DNA sequence :
ATGAACAATCGTATTTTAGTAGTTGATGATGAGGAGTTTATCTTAACTTTAATCGAATTTAATTTACAACAAGCTGGTTT
TGAAGTAATAACAGCGATGGATGGTGAGATGGCGCTGCAAAAAGCGACAACAGAACGTCCAGATTTAATTATATTAGATT
TAATGCTTCCAAAAATGGATGGTATGGAAGTATGTAAAGAATTACGATTGCAGCGCGTTATGACGCCAATTTTAATGTTA
ACAGCAAAAGATGATGAGTTTGATAAGGTGCTAGGTCTTGAACTTGGGGCGGATGATTATATGACGAAGCCATTTAGCCC
AAGGGAAGTTGTTGCACGTGTGAAGGCAATTTTACGCCGTACGAAATTACAACAAGAAGAGCAAGTTACAGAAACGTCAG
ATGAAGAGAGCATCACAATTGCTGAACTTAAAATTTTGCCGGAATTTTATGAAGCTTATTTCCAAGGAAGAAAGCTTGAA
TTAACACCAAAAGAATTTGAACTACTTGTTTATCTTGCGAAAAATAAAAGTCGCGTGTTGACACGTGATCAATTATTAAG
TGCTGTATGGAACTATGATTTTGCTGGTGATACACGAATTGTTGACGTTCATATTAGCCATTTGCGCGATAAAATTGAAC
AAAATACGAAAAAACCGACGTACATTAAAACGATACGTGGTTTAGGATATAAATTAGAGGAGCCAAAAGGGGATGAATAA

Protein sequence :
MNNRILVVDDEEFILTLIEFNLQQAGFEVITAMDGEMALQKATTERPDLIILDLMLPKMDGMEVCKELRLQRVMTPILML
TAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAILRRTKLQQEEQVTETSDEESITIAELKILPEFYEAYFQGRKLE
LTPKEFELLVYLAKNKSRVLTRDQLLSAVWNYDFAGDTRIVDVHISHLRDKIEQNTKKPTYIKTIRGLGYKLEEPKGDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-34 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator HE999704.1.gene2815. Protein 5e-73 66
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator NC_002745.1124361.p0 Protein 6e-75 64
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator NC_009782.5559369.p0 Protein 6e-75 64
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator NC_002951.3237708.p0 Protein 6e-75 64
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator NC_002952.2859905.p0 Protein 1e-74 64
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator NC_003923.1003749.p0 Protein 6e-75 64
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator NC_002758.1121668.p0 Protein 6e-75 64
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator NC_009641.5332272.p0 Protein 6e-75 64
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator NC_013450.8614421.p0 Protein 6e-75 64
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator NC_007793.3914279.p0 Protein 6e-75 64
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator NC_007622.3794472.p0 Protein 7e-75 64
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator NC_012469.1.7686381. Protein 1e-62 56
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator AE016830.1.gene1681. Protein 8e-64 55
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator NC_012469.1.7685629. Protein 5e-54 53
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator BAC0197 Protein 1e-28 44
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator AE000516.2.gene3505. Protein 5e-41 44
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator CP001918.1.gene5135. Protein 1e-31 44
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator FJ349556.1.orf0.gene Protein 2e-39 43
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator CP001485.1.gene721.p Protein 7e-36 43
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator CP004022.1.gene3215. Protein 2e-36 43
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator CP000647.1.gene4257. Protein 1e-34 43
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator BAC0533 Protein 1e-34 43
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator NC_005054.2598277.p0 Protein 2e-39 42
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator NC_014475.1.orf0.gen Protein 2e-39 42
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator AF155139.2.orf0.gene Protein 2e-38 42
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator NC_002695.1.915041.p Protein 2e-33 42
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator CP000034.1.gene3834. Protein 2e-33 42
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator CP001138.1.gene4273. Protein 8e-34 42
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator CP000034.1.gene2186. Protein 1e-36 42
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator BAC0596 Protein 8e-36 42
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator CP001918.1.gene3444. Protein 4e-36 42
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator NC_002695.1.916589.p Protein 1e-36 42
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator BAC0039 Protein 1e-36 42
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator CP001138.1.gene2239. Protein 8e-36 42
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator AF310956.2.orf0.gene Protein 2e-34 41
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator AE016830.1.gene2255. Protein 1e-33 41
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator U35369.1.gene1.p01 Protein 1e-33 41
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator AF162694.1.orf4.gene Protein 2e-35 41
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator CP004022.1.gene1676. Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator VFG1389 Protein 7e-36 46
H9401_4612 YP_006211666.1 Alkaline phosphatase synthesis response regulator VFG1386 Protein 2e-40 43