Gene Information

Name : H9401_3078 (H9401_3078)
Accession : YP_006210132.1
Strain : Bacillus anthracis H9401
Genome accession: NC_017729
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2964551 - 2965231 bp
Length : 681 bp
Strand : +
Note : -

DNA sequence :
ATGTTAATGCGAGTTCTTATTGTCGAAGATGAACAAGACTTACAAAATATATTAGTAAAGCGATTAAATGCAGAACATTA
TAGTGTCGATGCATGCGGGAATGGAGAAGATGCCTTAGATTATATAAACATGGCTACCTACGATTTGATCGTGCTTGACA
TTATGATTCCCGGAATAAATGGTTTACAAGTATTACAAAAATTACGCGCGGACAATCATACAACTTCTGTCTTGCTTCTT
ACAGCTAAAGATACAATTGATGATCGCGTAAAAGGACTCGACTTAGGTGCGGACGATTATTTAGTAAAGCCGTTCGCTTT
TGACGAACTGCTAGCAAGAATTCGAGTGTTAATGCGAAGAAAAACAGGAAATACATCTAATGTGTTTGAAATTGCTGACC
TAGTGGTGGATTGCAATATGCATAAAGTAACAAGAGGAGACCAAGTTATTACTCTTTCCAGTAAAGAATTTGCTATTTTA
GAATATATGATTCGTAATAAAGAAGTTGTGTTGACACGAGATAAAATTGAGCAACATGTGTGGAATTACGACTATGAAGG
TGGCTCAAATATTATTGATGTTTACGTCCGCTATCTTCGAAAAAAAGTTGATAGCCAGTTTGAAACGAAGTTAATTCATA
CAGTAAGAGGAACTGGTTACGTATTGCGAGTAGAATCATGA

Protein sequence :
MLMRVLIVEDEQDLQNILVKRLNAEHYSVDACGNGEDALDYINMATYDLIVLDIMIPGINGLQVLQKLRADNHTTSVLLL
TAKDTIDDRVKGLDLGADDYLVKPFAFDELLARIRVLMRRKTGNTSNVFEIADLVVDCNMHKVTRGDQVITLSSKEFAIL
EYMIRNKEVVLTRDKIEQHVWNYDYEGGSNIIDVYVRYLRKKVDSQFETKLIHTVRGTGYVLRVES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-42 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-41 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H9401_3078 YP_006210132.1 two-component response regulator BAC0111 Protein 7e-52 49
H9401_3078 YP_006210132.1 two-component response regulator BAC0308 Protein 4e-49 48
H9401_3078 YP_006210132.1 two-component response regulator BAC0125 Protein 9e-48 48
H9401_3078 YP_006210132.1 two-component response regulator BAC0638 Protein 2e-46 48
H9401_3078 YP_006210132.1 two-component response regulator BAC0347 Protein 8e-45 47
H9401_3078 YP_006210132.1 two-component response regulator BAC0197 Protein 3e-49 47
H9401_3078 YP_006210132.1 two-component response regulator BAC0083 Protein 2e-49 45
H9401_3078 YP_006210132.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-41 44
H9401_3078 YP_006210132.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-41 44
H9401_3078 YP_006210132.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-41 44
H9401_3078 YP_006210132.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-41 44
H9401_3078 YP_006210132.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-41 44
H9401_3078 YP_006210132.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-41 44
H9401_3078 YP_006210132.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-41 44
H9401_3078 YP_006210132.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-41 44
H9401_3078 YP_006210132.1 two-component response regulator AE015929.1.gene1106. Protein 8e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H9401_3078 YP_006210132.1 two-component response regulator VFG1390 Protein 2e-48 45
H9401_3078 YP_006210132.1 two-component response regulator VFG0596 Protein 3e-42 43
H9401_3078 YP_006210132.1 two-component response regulator VFG1386 Protein 1e-45 42