Gene Information

Name : H9401_2382 (H9401_2382)
Accession : YP_006209436.1
Strain : Bacillus anthracis H9401
Genome accession: NC_017729
Putative virulence/resistance : Resistance
Product : Beta-lactamase 1 precursor
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2318799 - 2319689 bp
Length : 891 bp
Strand : +
Note : -

DNA sequence :
ATGTGTGTTGGTATATTAGGTTTAAGTATTACAAGCCTAGTAACTTTTACAGGAGGTGCATTGCAAGTTGAAGCGAAAGA
AAAGACTGGACAAGTGAAACATAAAAATCAGGCGACGCATAAAGAGTTCTCTCAACTTGAGAAAAAATTTGATGCTCGAT
TAGGTGTATATGCGATTGATACTGGTACAAATCAAACAATCGCTTATCGACCTAACGAAAGGTTTGCCTTTGCATCAACT
TACAAGGCTTTAGCGGCAGGGGTATTACTGCAACAGAACTCTACTAAGAAATTAGATGAAGTTATTACTTATACGAAAGA
AGACTTAGTGGATTATTCACCTGTTACAGAGAAACATGTAGATACTGGAATGACACTAGGAGAAATTGCGGAGGCTGCTG
TTCGTTACAGTGATAATACTGCAGGGAACATTTTATTTCATAAAATAGGCGGACCGAAAGGATATGAAAAAGCGCTTAGA
CAGATGGGGGACCGGGTTACTATGTCTGATCGTTTTGAAACAGAATTAAACGAGGCTATTCCAGGAGACATTCGTGACAC
CAGTACAGCGAAAGCAATTGCTACGAATCTTAAAGCTTTTACGGCCGGAAATGCGCTTCCAAATCATAAACGTAACATTC
TTACAAAGTGGATGAAAGGAAATGCTACAGGAGACAAACTTATTCGTGCAGGTGTGCCTACTAACTGGGTAGTTGCAGAT
AAATCAGGAGCTGGAAGTTACGGGACACGAAATGATATTGCTATCGTTTGGCCACCAAATAGAGCACCTATTATCATCGC
AATTTTATCTAGTAAAGATGAAAAAGGGGCTACCTATGATAATCAACTCATTGCAGAGGCGGCTGAAGTTATAGTTAATG
CTTTTAGGTGA

Protein sequence :
MCVGILGLSITSLVTFTGGALQVEAKEKTGQVKHKNQATHKEFSQLEKKFDARLGVYAIDTGTNQTIAYRPNERFAFAST
YKALAAGVLLQQNSTKKLDEVITYTKEDLVDYSPVTEKHVDTGMTLGEIAEAAVRYSDNTAGNILFHKIGGPKGYEKALR
QMGDRVTMSDRFETELNEAIPGDIRDTSTAKAIATNLKAFTAGNALPNHKRNILTKWMKGNATGDKLIRAGVPTNWVVAD
KSGAGSYGTRNDIAIVWPPNRAPIIIAILSSKDEKGATYDNQLIAEAAEVIVNAFR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
blaCTX-M2 ACF06162.1 beta-lactamase CTX-M2 Not tested Tn5036-like Protein 1e-50 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF367983.gene.p01 Protein 1e-136 100
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor EU729727.1.gene1.p1 Protein 2e-52 48
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor EU555534.1.gene1.p01 Protein 2e-51 48
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor HM066995.1.gene1.p01 Protein 9e-51 48
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor HQ641421.1.gene1.p01 Protein 7e-51 48
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF297554.1.gene1.p1 Protein 9e-51 48
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY034847.1.gene1.p01 Protein 4e-51 48
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF275256.gene.p01 Protein 2e-53 47
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF395881.gene.p01 Protein 4e-52 47
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor GQ140348.1.gene1.p01 Protein 5e-52 47
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor FJ234412.1.gene1.p01 Protein 2e-52 47
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor Z28968.gene.p01 Protein 7e-52 46
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ663489.gene.p01 Protein 5e-49 46
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY005110.1.gene1.p1 Protein 2e-47 46
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ328639.gene.p01 Protein 5e-49 46
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor EF581888.1.gene1.p01 Protein 9e-51 45
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor U50278.1.gene2.p01 Protein 2e-53 45
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor HM776707.1.gene1.p1 Protein 7e-51 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AJ567481.1.gene1.p01 Protein 1e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ125241.gene.p01 Protein 7e-51 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor GQ149243.1.gene1.p01 Protein 4e-51 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor GU127598.1.gene1.p1 Protein 7e-51 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AJ416344.1.gene1.p01 Protein 2e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ102702.1.gene1.p1 Protein 1e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor EF374097.1.gene1.p01 Protein 6e-51 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor X92507.1.gene1.p01 Protein 7e-51 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ408762.1.gene1.p1 Protein 7e-51 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor GQ149244.1.gene1.p01 Protein 7e-51 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AB205197.1.gene1.p01 Protein 1e-48 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY750914.gene.p01 Protein 2e-48 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor FJ214368.1.gene1.p1 Protein 1e-49 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor HM167760.1.gene1.p01 Protein 5e-49 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor FJ214366.1.gene1.p1 Protein 1e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF174129.3.gene9.p01 Protein 3e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY847147.1.gene1.p01 Protein 1e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY847143.1.gene1.p01 Protein 3e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY847144.1.gene1.p01 Protein 9e-51 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor FJ214367.1.gene1.p1 Protein 2e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY847145.1.gene1.p01 Protein 5e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor FJ214369.1.gene1.p1 Protein 1e-49 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF189721.1.gene1.p01 Protein 5e-49 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor HQ398215.1.gene1.p01 Protein 7e-51 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF252622.2.gene2.p01 Protein 1e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY029068.1.gene1.p1 Protein 2e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF252623.2.gene1.p01 Protein 2e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor HQ833651.1.gene1.p01 Protein 1e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor FJ907381.1.gene1.p01 Protein 2e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY157676.1.gene1.p01 Protein 1e-48 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY156923.1.gene1.p01 Protein 9e-51 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor EF418608.1.gene1.p01 Protein 4e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY847146.1.gene1.p01 Protein 2e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor HQ166709.1.gene1.p01 Protein 8e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor EU136031.3.gene1.p3 Protein 8e-51 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY033516.1.gene2.p01 Protein 1e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AJ416345.gene.p01 Protein 3e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor HM755448.1.gene1.p01 Protein 2e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor JF274246.1.gene1.p01 Protein 1e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor JF274247.1.gene1.p01 Protein 3e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF325134.1.gene1.p1 Protein 9e-51 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor HM803271.1.gene1.p01 Protein 2e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ023162.1.gene1.p1 Protein 6e-48 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF325133.1.gene1.p1 Protein 1e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY143430.1.gene1.p01 Protein 2e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY822595.1.gene1.p01 Protein 2e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor EU545409.1.gene1.p1 Protein 4e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor JF274243.1.gene1.p01 Protein 6e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AM982522.2.gene1.p01 Protein 4e-48 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor HQ833652.1.gene1.p01 Protein 1e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor HQ913565.1.gene1.p01 Protein 2e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor JF274242.1.gene1.p01 Protein 7e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY267213.1.gene1.p01 Protein 5e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AB177384.1.gene1.p01 Protein 6e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor EF210159.1.gene1.p01 Protein 5e-50 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AB284167.2.gene1.p01 Protein 9e-51 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF135373.1.gene1.p01 Protein 4e-47 44
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY303807.gene.p01 Protein 4e-48 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor U95364.1.gene1.p01 Protein 2e-50 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor FJ971899.1.gene1.p1 Protein 9e-48 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ211987.1.gene1.p01 Protein 7e-50 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor GQ870432.1.gene1.p1 Protein 7e-48 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY954516.1.gene1.p1 Protein 5e-48 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF518567.2.gene4.p01 Protein 7e-48 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AJ549244.1.gene1.p01 Protein 8e-50 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor EU177100.1.gene1.p01 Protein 9e-50 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ061159.1.gene1.p01 Protein 6e-50 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ268764.2.gene6.p01 Protein 9e-50 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY995206.gene.p01 Protein 9e-50 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor EF426798.1.gene1.p1 Protein 1e-49 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY238472.1.gene1.p01 Protein 6e-50 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor X92506.gene.p01 Protein 1e-49 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF255298.1.gene1.p1 Protein 2e-49 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AJ704396.1.gene1.p01 Protein 8e-50 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor EU202673.2.gene1.p2 Protein 1e-49 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF488377.1.gene1.p1 Protein 9e-50 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor JF966749.1.gene1.p01 Protein 2e-49 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor Y10278.1.gene1.p01 Protein 1e-49 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY649755.1.gene1.p01 Protein 9e-50 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY292654.1.gene1.p1 Protein 7e-50 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor EF219142.1.gene1.p01 Protein 1e-49 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AJ557142.gene.p01 Protein 9e-50 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor HQ398214.1.gene1.p01 Protein 2e-49 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor FJ873739.1.gene1.p01 Protein 5e-50 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor EU402393.1.gene1.p1 Protein 7e-50 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY080894.1.gene1.p01 Protein 1e-49 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor GQ351346.1.gene1.p01 Protein 9e-50 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF305837.gene.p01 Protein 9e-50 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY598759.gene.p01 Protein 2e-49 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY178993.1.gene1.p01 Protein 3e-47 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY037780.1.gene1.p01 Protein 7e-41 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor U14748.1.gene2.p01 Protein 3e-45 43
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor Y14156.1.gene1.p01 Protein 2e-48 42
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AJ005045.gene.p01 Protein 4e-48 42
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AM411407.1.gene1.p01 Protein 2e-49 42
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ256091.1.gene1.p1 Protein 1e-49 42
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor FJ815436.1.gene1.p01 Protein 5e-49 42
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ885477.1.gene1.p01 Protein 2e-49 42
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ810789.1.gene1.p01 Protein 2e-49 42
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY847148.1.gene1.p01 Protein 1e-48 42
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor JN227085.1.gene1.p01 Protein 5e-49 42
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ223685.1.gene1.p01 Protein 1e-49 42
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY515297.1.gene1.p1 Protein 1e-48 42
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AM176552.2.gene1.p01 Protein 8e-41 42
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF313471.1.gene2.p01 Protein 8e-41 42
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor NC_003140.1122765.p0 Protein 1e-45 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor NC_005011.2598316.p0 Protein 1e-45 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor NC_007931.3978604.p0 Protein 1e-45 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor NC_005951.2853409.p0 Protein 1e-45 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY590467.1.gene1.p1 Protein 1e-40 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor FJ197316.1.gene1.p1 Protein 5e-40 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF427127.1.gene1.p01 Protein 4e-39 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor X54606.1.gene1.p01 Protein 1e-39 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor EF136377.1.gene1.p01 Protein 1e-39 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor Y17582.1.gene1.p01 Protein 3e-39 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor FJ405211.1.gene1.p01 Protein 1e-39 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor HQ661362.1.gene1.p1 Protein 5e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor GQ428198.1.gene1.p01 Protein 5e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor JX268752.1.gene1.p01 Protein 6e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor EF373971.1.gene1.p01 Protein 9e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor HQ637576.1.gene1.p01 Protein 2e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ193536.1.gene1.p01 Protein 7e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AM176549.2.gene1.p01 Protein 6e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AJ866284.2.gene1.p01 Protein 6e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor EU032604.1.gene1.p01 Protein 2e-40 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor EU418913.1.gene1.p01 Protein 7e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ322460.1.gene1.p1 Protein 6e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor HM751100.1.gene1.p01 Protein 1e-40 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AM176557.2.gene1.p01 Protein 5e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY277255.2.gene1.p01 Protein 7e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor JQ029959.1.gene1.p01 Protein 6e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ013287.1.gene1.p1 Protein 1e-40 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY070258.1.gene1.p1 Protein 3e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AM176551.2.gene1.p01 Protein 7e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF467947.1.gene1.p1 Protein 6e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF535128.1.gene1.p01 Protein 9e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF467948.1.gene1.p1 Protein 6e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AF208796.2.gene1.p01 Protein 6e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ174304.1.gene1.p01 Protein 5e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor CP000647.1.gene1607. Protein 6e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ836922.1.gene1.p01 Protein 1e-40 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AM176555.2.gene1.p01 Protein 4e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor DQ174308.1.gene1.p01 Protein 7e-41 41
H9401_2382 YP_006209436.1 Beta-lactamase 1 precursor AY123251.gene6.p01 Protein 5e-40 41