Gene Information

Name : merR (SMD_1558)
Accession : YP_006184289.1
Strain : Stenotrophomonas maltophilia D457
Genome accession: NC_017671
Putative virulence/resistance : Resistance
Product : mercuric resistance operon regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1721540 - 1721947 bp
Length : 408 bp
Strand : +
Note : -

DNA sequence :
ATGGAGAACGCTCAAGAGAATCTGACCATCGGGGCCTTCGCCAAGGCAGCCCGGGTCAACGTGGAGACGATCCGCTTCTA
TCAGCTCAAGGGCTTGCTACCCCAGCCGGAGCGGCCCTACGGTCGCATCCGCCGCTACGGGCAGGCGGACGTGGCGCGGG
TGAAGTTCGTGAAGTCAGCCCAGCGCCTGGGATTCAGCCTGGATGAAGTCGGCCAGCTCCTGAAACTGGAGGACGGCACC
CATTGCAGCGAGGCGGCCGAACTGGCTGCTCACCGGCTGGCCGATGTGCGCGCACGCATGGCGGACCTCACGCGGATGGA
AGAGGCCCTGTCGACGCTAGTGAGAGAGTGCAACGCGCACCATGGCAATGTTTCCTGCCCGTTGATCGCAGCTTTGCATT
GCTGCTAA

Protein sequence :
MENAQENLTIGAFAKAARVNVETIRFYQLKGLLPQPERPYGRIRRYGQADVARVKFVKSAQRLGFSLDEVGQLLKLEDGT
HCSEAAELAAHRLADVRARMADLTRMEEALSTLVRECNAHHGNVSCPLIAALHCC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-59 100
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-44 73
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-44 73
merR ACK44535.1 MerR Not tested SGI1 Protein 3e-45 73
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 3e-45 73
merR AFG30124.1 MerR Not tested PAGI-2 Protein 3e-45 73
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 5e-45 73
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 4e-45 73
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 6e-45 73
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 4e-43 70
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 3e-25 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merR YP_006184289.1 mercuric resistance operon regulatory protein BAC0688 Protein 5e-46 76
merR YP_006184289.1 mercuric resistance operon regulatory protein BAC0683 Protein 6e-47 73
merR YP_006184289.1 mercuric resistance operon regulatory protein BAC0232 Protein 2e-45 73
merR YP_006184289.1 mercuric resistance operon regulatory protein BAC0687 Protein 2e-45 73
merR YP_006184289.1 mercuric resistance operon regulatory protein BAC0684 Protein 1e-46 73
merR YP_006184289.1 mercuric resistance operon regulatory protein BAC0686 Protein 1e-46 72
merR YP_006184289.1 mercuric resistance operon regulatory protein BAC0689 Protein 2e-44 71