Gene Information

Name : WFL_22630 (WFL_22630)
Accession : YP_006175948.1
Strain : Escherichia coli W
Genome accession: NC_017664
Putative virulence/resistance : Virulence
Product : antitoxin of the YeeV-YeeU toxin-antitoxin system; CP4-44 prophage
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4770553 - 4770888 bp
Length : 336 bp
Strand : +
Note : -

DNA sequence :
ATGCTGCAAAAGGACAAGGTCATGCAACAAGAATGGGGGCTTCCCTGTACCGTAACACCACGCTTCACTGCTCGACTGGT
ACAGGAAAGACATAACCTGCATTACCTGGCTGATCGGGCCGCAATCACCGGGAAATTCAGCTCCCCGGATCTGCTGCATA
TCGACCAGGCTTTTCCGGTGCTGATGAAACAACTGGAGCTGAAACTGGCTGACGGTGAACTCTCCCCCTGGCAACAACGT
ACCGTCACGCTATACGCCAAAGGACTAACCTGCGAAGCCGATACGCTGGGTTCCTGTGGTTACGTCTATATCGCTATTTA
TCCCACTCAACGCTGA

Protein sequence :
MLQKDKVMQQEWGLPCTVTPRFTARLVQERHNLHYLADRAAITGKFSSPDLLHIDQAFPVLMKQLELKLADGELSPWQQR
TVTLYAKGLTCEADTLGSCGYVYIAIYPTQR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeU NP_838486.1 structural protein Not tested SHI-1 Protein 3e-33 76
yeeU NP_708772.1 structural protein Not tested SHI-1 Protein 3e-33 76
ECO103_3591 YP_003223448.1 hypothetical protein Not tested LEE Protein 2e-33 76
unnamed AAK00481.1 unknown Not tested SHI-1 Protein 2e-33 76
yeeU CAD42100.1 hypothetical protein Not tested PAI II 536 Protein 6e-33 75
aec75 AAW51758.1 Aec75 Not tested AGI-3 Protein 3e-33 75
yeeU ADD91700.1 YeeU Not tested PAI-I AL862 Protein 8e-33 75
yeeU YP_853121.1 antitoxin of the YeeV-YeeU toxin-antitoxin system Virulence PAI IV APEC-O1 Protein 4e-32 74
Z1220 NP_286755.1 structural protein Not tested TAI Protein 3e-31 74
Z1658 NP_287161.1 structural protein Not tested TAI Protein 3e-31 74
unnamed AAL08477.1 unknown Not tested SRL Protein 2e-31 72
unnamed CAD66206.1 hypothetical protein Not tested PAI III 536 Protein 2e-31 70

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
WFL_22630 YP_006175948.1 antitoxin of the YeeV-YeeU toxin-antitoxin system; CP4-44 prophage VFG0662 Protein 7e-34 76
WFL_22630 YP_006175948.1 antitoxin of the YeeV-YeeU toxin-antitoxin system; CP4-44 prophage VFG1619 Protein 2e-33 75
WFL_22630 YP_006175948.1 antitoxin of the YeeV-YeeU toxin-antitoxin system; CP4-44 prophage VFG1068 Protein 8e-32 72
WFL_22630 YP_006175948.1 antitoxin of the YeeV-YeeU toxin-antitoxin system; CP4-44 prophage VFG1681 Protein 7e-32 70