Gene Information

Name : WFL_22605 (WFL_22605)
Accession : YP_006175943.1
Strain : Escherichia coli W
Genome accession: NC_017664
Putative virulence/resistance : Virulence
Product : phage transcriptional regulator AlpA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4766500 - 4766718 bp
Length : 219 bp
Strand : -
Note : COG3311 Predicted transcriptional regulator

DNA sequence :
ATGAACAATCAACCGAATACCGATACTGACCTGATGAATGACAAACTGGTGACGATGGCATTTATTACCACGTTTACTGG
CCTGACCGACAAATGGTTTTATAAACTGATTAGTGAAGGAAAGTTTCCAAAGCCTATCAAACTGGGGCGTAGTTCCCGCT
GGCGGGAAAGTGAAGTTAAACGCTGGCTGACGGAACGTATTGCAGAATCCCGCTATTAA

Protein sequence :
MNNQPNTDTDLMNDKLVTMAFITTFTGLTDKWFYKLISEGKFPKPIKLGRSSRWRESEVKRWLTERIAESRY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 9e-18 72
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-17 72
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 7e-18 70
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 9e-18 69
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 6e-18 69
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 1e-17 69
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 1e-17 69
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 1e-17 68
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 1e-17 68
unnamed AAL08466.1 unknown Not tested SRL Protein 2e-17 66

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
WFL_22605 YP_006175943.1 phage transcriptional regulator AlpA VFG1480 Protein 4e-18 72
WFL_22605 YP_006175943.1 phage transcriptional regulator AlpA VFG0651 Protein 4e-18 69
WFL_22605 YP_006175943.1 phage transcriptional regulator AlpA VFG1057 Protein 6e-18 66