
|
Name : WFL_19260 (WFL_19260) Accession : YP_006175280.1 Strain : Escherichia coli W Genome accession: NC_017664 Putative virulence/resistance : Virulence Product : phage regulatory protein Function : - COG functional category : - COG ID : - EC number : - Position : 4047065 - 4047268 bp Length : 204 bp Strand : - Note : COG3311 Predicted transcriptional regulator DNA sequence : ATGAGCACCATTGATATTTATAACGATAAGTTCGTCAGCATGCAGTTCATTACTGAACTGACTGGGTTATCCGATAAATG GTTTTATAAGCTTGCACAGGAAGGTAAGTTTCCAAAACCTGTAAAGTTTGGTCGTAGTTCCCGCTGGATTGAACGTGAAG TAAAAGAATGGTTAGAAGCCCGCATTAATGACTCGAGAGCATAA Protein sequence : MSTIDIYNDKFVSMQFITELTGLSDKWFYKLAQEGKFPKPVKFGRSSRWIEREVKEWLEARINDSRA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 3e-17 | 57 |
| S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 8e-17 | 57 |
| SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 8e-17 | 57 |
| ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 4e-17 | 57 |
| rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 5e-17 | 57 |
| Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 5e-12 | 56 |
| Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 5e-12 | 56 |
| unnamed | ADD91712.1 | putative transcriptional regulator AlpA | Not tested | PAI-I AL862 | Protein | 5e-17 | 56 |
| unnamed | CAI43835.1 | hypothetical protein | Not tested | LEE | Protein | 5e-17 | 56 |
| c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 3e-15 | 55 |
| unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 2e-15 | 55 |
| unnamed | AAL08466.1 | unknown | Not tested | SRL | Protein | 7e-17 | 54 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| WFL_19260 | YP_006175280.1 | phage regulatory protein | VFG0651 | Protein | 2e-17 | 57 |
| WFL_19260 | YP_006175280.1 | phage regulatory protein | VFG1480 | Protein | 9e-16 | 55 |
| WFL_19260 | YP_006175280.1 | phage regulatory protein | VFG1057 | Protein | 3e-17 | 54 |