Gene Information

Name : silR (P12B_c3611)
Accession : YP_006170599.1
Strain : Escherichia coli P12b
Genome accession: NC_017663
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator in two-component regulatory system with CusS
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3925025 - 3925705 bp
Length : 681 bp
Strand : +
Note : -

DNA sequence :
ATGAAAATATTGATCGTCGAAGACGAAATTAAAACAGGTGAATATCTCAGCAAAGGGCTTACAGAGGCAGGGTTCGTAGT
GGATCACGCTGATAATGGTCTTACCGGATATCATCTCGCCATGACAGCCGAGTATGATTTAGTCATTCTGGATATCATGC
TACCTGATGTGAACGGCTGGGATATCATCCGCATGCTGCGCACTGCCGGAAAGGGTATGCCGGTCTTACTGCTGACAGCC
CTCGGCACGATCGAACACAGGGTCAAAGGACTGGAACTGGGTGCGGACGATTATCTGGTTAAACCCTTTGCGTTTGCCGA
ACTGCTCGCCCGGGTGAGAACCCTTCTGAGGCGGGGAAACACGATGATCACGGAAAGCCAGTTTAAGGTGGCTGACCTCT
CGATTGATCTCGTATCCAGAAAAGTCAGTCGCGCCGGAAACCGCATTGTGCTCACCAGTAAAGAGTTCAGCCTGCTGGAA
TTCTTCATTCGCCATCAGGGAGAGGTTCTTCCCCGCTCCCTGATTGCCTCTCAGGTCTGGGACATGAATTTTGACAGCGA
CACTAATGCGATCGATGTCGCAGTAAAGCGACTCCGCGCTAAAATAGACAACGATTACGGGACAAAGCTGATCCAGACAG
TCCGGGGCGTGGGCTACATGCTGGAGGTCCCGGATGCATAG

Protein sequence :
MKILIVEDEIKTGEYLSKGLTEAGFVVDHADNGLTGYHLAMTAEYDLVILDIMLPDVNGWDIIRMLRTAGKGMPVLLLTA
LGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRGNTMITESQFKVADLSIDLVSRKVSRAGNRIVLTSKEFSLLE
FFIRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRAKIDNDYGTKLIQTVRGVGYMLEVPDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-55 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-54 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
silR YP_006170599.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0347 Protein 3e-95 94
silR YP_006170599.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0111 Protein 3e-95 87
silR YP_006170599.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0638 Protein 1e-64 62
silR YP_006170599.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0083 Protein 1e-70 61
silR YP_006170599.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0197 Protein 3e-65 60
silR YP_006170599.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0308 Protein 7e-62 58
silR YP_006170599.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0125 Protein 2e-63 56
silR YP_006170599.1 DNA-binding response regulator in two-component regulatory system with CusS HE999704.1.gene1202. Protein 4e-36 41
silR YP_006170599.1 DNA-binding response regulator in two-component regulatory system with CusS AE000516.2.gene3505. Protein 4e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
silR YP_006170599.1 DNA-binding response regulator in two-component regulatory system with CusS VFG0596 Protein 1e-55 54
silR YP_006170599.1 DNA-binding response regulator in two-component regulatory system with CusS VFG1390 Protein 3e-42 43
silR YP_006170599.1 DNA-binding response regulator in two-component regulatory system with CusS VFG1389 Protein 4e-34 41