Gene Information

Name : P12B_c3603 (P12B_c3603)
Accession : YP_006170592.1
Strain : Escherichia coli P12b
Genome accession: NC_017663
Putative virulence/resistance : Unknown
Product : ISEc8 transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3913656 - 3914003 bp
Length : 348 bp
Strand : +
Note : -

DNA sequence :
ATGATAAATCTTCCCGCAGGCACAAAAATCTGGCTGGTTGCCGGTATCACCGATATGCGCAACGGCTTCAATGGCCTCGC
CGCAAAGGTGCAGACCGCGCTGAAAGATGACCCGATGTCCGGCCACGTCTTCATCTTCCGGGGACGCAGCGGCAGTCAGG
TAAAACTGCTCTGGTCCACCGGCGATGGTCTGTGCCTGCTGACAAAGCGACTGGAACGTGGTCGCTTCGCCTGGCCCTCA
GCCCGCGATGGCAAAGTGTTCCTGACGCCGGCGCAACTGGCGATGCTGATGGAAGGTATCGACTGGCGACAGCCAAAGCG
GTTACTGACATCCCTGACCATGTTGTAG

Protein sequence :
MINLPAGTKIWLVAGITDMRNGFNGLAAKVQTALKDDPMSGHVFIFRGRSGSQVKLLWSTGDGLCLLTKRLERGRFAWPS
ARDGKVFLTPAQLAMLMEGIDWRQPKRLLTSLTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAC31493.1 L0014 Not tested LEE Protein 6e-48 97
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 8e-48 97
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 6e-48 97
unnamed AAL99258.1 unknown Not tested LEE Protein 6e-48 97
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 6e-48 97
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-35 97
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 4e-47 97
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 4e-47 97
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 8e-48 97
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 8e-48 97
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 8e-48 97
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-48 96
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-48 96
unnamed AAL08461.1 unknown Not tested SRL Protein 1e-47 95
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-39 77
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-39 77
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-39 76
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-37 72
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-37 72
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-29 67
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 5e-34 64
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 5e-34 64
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 9e-35 63
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-34 63
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 9e-35 63

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
P12B_c3603 YP_006170592.1 ISEc8 transposase VFG0792 Protein 2e-48 97
P12B_c3603 YP_006170592.1 ISEc8 transposase VFG1517 Protein 5e-36 97
P12B_c3603 YP_006170592.1 ISEc8 transposase VFG1709 Protein 2e-48 97
P12B_c3603 YP_006170592.1 ISEc8 transposase VFG1698 Protein 1e-48 96
P12B_c3603 YP_006170592.1 ISEc8 transposase VFG1052 Protein 5e-48 95
P12B_c3603 YP_006170592.1 ISEc8 transposase VFG1665 Protein 9e-40 76
P12B_c3603 YP_006170592.1 ISEc8 transposase VFG1737 Protein 3e-35 63