Gene Information

Name : yfjZ (P12B_c3166)
Accession : YP_006170167.1
Strain : Escherichia coli P12b
Genome accession: NC_017663
Putative virulence/resistance : Virulence
Product : antitoxin of the YpjF-YfjZ toxin-antitoxin system
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3462896 - 3463204 bp
Length : 309 bp
Strand : -
Note : -

DNA sequence :
ATGACCTGGGGCCTGCAGCGTGACGTCACACCACGCTTCGGTGTCCGGCTGGTGCAGGAGAGCAACCGACTGCACTATCT
GTCTGACCGGGCCAGTATCACCGGTAAGTTCAGTGACGTTGAATGTCTAAGGCTGGATGAAGCATTCCCGCACTTTGTCC
GTCAGATGGAATTGATGCTGACCACTGGCGATCTGAATCCTCGCCATACACACTGCGTCACCCTGTACCACAACGGTTTT
ACCTGTGAAGCCGACACCCTTGGCAGTTGCGGCTACGTATACATCGCCATTTACCCCACTCAGCGTTAA

Protein sequence :
MTWGLQRDVTPRFGVRLVQESNRLHYLSDRASITGKFSDVECLRLDEAFPHFVRQMELMLTTGDLNPRHTHCVTLYHNGF
TCEADTLGSCGYVYIAIYPTQR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeU NP_838486.1 structural protein Not tested SHI-1 Protein 8e-31 70
yeeU NP_708772.1 structural protein Not tested SHI-1 Protein 8e-31 70
unnamed AAK00481.1 unknown Not tested SHI-1 Protein 5e-31 70
yeeU ADD91700.1 YeeU Not tested PAI-I AL862 Protein 1e-29 69
ECO103_3591 YP_003223448.1 hypothetical protein Not tested LEE Protein 1e-29 69
yeeU CAD42100.1 hypothetical protein Not tested PAI II 536 Protein 7e-30 68
aec75 AAW51758.1 Aec75 Not tested AGI-3 Protein 4e-30 68
unnamed CAD66206.1 hypothetical protein Not tested PAI III 536 Protein 2e-28 67
yeeU YP_853121.1 antitoxin of the YeeV-YeeU toxin-antitoxin system Virulence PAI IV APEC-O1 Protein 4e-29 67
Z1220 NP_286755.1 structural protein Not tested TAI Protein 3e-28 66
Z1658 NP_287161.1 structural protein Not tested TAI Protein 3e-28 66
unnamed AAL08477.1 unknown Not tested SRL Protein 2e-28 64

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yfjZ YP_006170167.1 antitoxin of the YpjF-YfjZ toxin-antitoxin system VFG0662 Protein 2e-31 70
yfjZ YP_006170167.1 antitoxin of the YpjF-YfjZ toxin-antitoxin system VFG1619 Protein 3e-30 68
yfjZ YP_006170167.1 antitoxin of the YpjF-YfjZ toxin-antitoxin system VFG1681 Protein 7e-29 67
yfjZ YP_006170167.1 antitoxin of the YpjF-YfjZ toxin-antitoxin system VFG1068 Protein 9e-29 64