Gene Information

Name : P12B_c2093 (P12B_c2093)
Accession : YP_006169111.1
Strain : Escherichia coli P12b
Genome accession: NC_017663
Putative virulence/resistance : Virulence
Product : Putative transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2253526 - 2253732 bp
Length : 207 bp
Strand : +
Note : -

DNA sequence :
ATGGCTACCCCAGTTTCGCTGATGGATGACCAGATGGTCGACATGGCGTTTATCACTCAACTGACCGGCCTAACCGATAA
GTGGTTTGACAAACTCATCAAAGATGGGGGCTTTCCTGCGCCCATCAAAATGGGGCGCAGCTCCCGCTGGCTGAAAAGTG
AAGTGGAAGCCTGGCTGCAGGCGCGTATTGCACAGTCCCGTCCGTAA

Protein sequence :
MATPVSLMDDQMVDMAFITQLTGLTDKWFDKLIKDGGFPAPIKMGRSSRWLKSEVEAWLQARIAQSRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 5e-25 96
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 5e-25 96
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 3e-25 95
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 7e-25 93
unnamed AAL08466.1 unknown Not tested SRL Protein 9e-25 92
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 2e-24 90
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 2e-24 90
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 1e-24 90
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-16 67
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 2e-16 67
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 2e-13 66
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 2e-13 66

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
P12B_c2093 YP_006169111.1 Putative transcriptional regulator VFG1057 Protein 4e-25 92
P12B_c2093 YP_006169111.1 Putative transcriptional regulator VFG0651 Protein 4e-25 90
P12B_c2093 YP_006169111.1 Putative transcriptional regulator VFG1480 Protein 6e-17 67