Gene Information

Name : KO11_08775 (KO11_08775)
Accession : YP_006164088.1
Strain : Escherichia coli KO11FL
Genome accession: NC_017660
Putative virulence/resistance : Unknown
Product : putative IS602 transposase OrfA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1863590 - 1863901 bp
Length : 312 bp
Strand : +
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
ATGAACAAGAAAACCAAACGAACCTTCACCCCTGAGTTCAGGCTGGAATGTGCACAGCTGATTGTTGATAAGGGCTACTC
ATATCGACAGGCCAGTGAAGCGATGAATGTCGGTTCAACCACGCTTGAGAGCTGGGTACGCCAGCTCAGGCGAGAGCGCC
AGGGTATTACGCCCTCTGCCACACCCATTACTCCAGACCAGCAACGTATCCGCGAGCTGGAAAAGCAAGTTCGCCGTCTG
GAGGAACAAAATACGATATTAAAAAAGGCTACCGCGCTCTTAATGTCCGACTCGCTGAACGGTTCACGATAG

Protein sequence :
MNKKTKRTFTPEFRLECAQLIVDKGYSYRQASEAMNVGSTTLESWVRQLRRERQGITPSATPITPDQQRIRELEKQVRRL
EEQNTILKKATALLMSDSLNGSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-43 100
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-43 100
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 5e-42 98
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 3e-42 98
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-42 98
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 3e-42 98
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-28 64
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-28 64
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-28 64
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-28 64
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-28 64
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-28 64
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-28 64
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-28 64
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-24 62
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-24 61
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-24 61
api80 CAF28554.1 putative transposase Not tested YAPI Protein 1e-19 56
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 7e-23 54
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-20 52
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 5e-22 51
tnpA CAB61575.1 transposase A Not tested HPI Protein 6e-20 51

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KO11_08775 YP_006164088.1 putative IS602 transposase OrfA VFG0784 Protein 8e-43 98
KO11_08775 YP_006164088.1 putative IS602 transposase OrfA VFG1123 Protein 6e-29 64
KO11_08775 YP_006164088.1 putative IS602 transposase OrfA VFG1485 Protein 6e-25 61
KO11_08775 YP_006164088.1 putative IS602 transposase OrfA VFG1553 Protein 3e-23 54