Gene Information

Name : NRG857_30139 (NRG857_30139)
Accession : YP_006162260.1
Strain :
Genome accession: NC_017659
Putative virulence/resistance : Resistance
Product : mercury resistance operon mercuric transport protein MerP; periplasmic component
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 72779 - 73054 bp
Length : 276 bp
Strand : -
Note : Sequence similarity to: YP_001096338.1 hypothetical protein pLEW517_p13 [Escherichia coli] & NP_052883.1 mercuric transport protein periplasmic component precursor [Plasmid R100]; TIGR02052, MerP, mercuric transport protein periplasmic component

DNA sequence :
ATGAAGAAACTGTTTGCCTCCCTTGCCCTCGCCGCCGCTGTTGCCCCGGTGTGGGCCGCTACCCAGACCGTCACGCTAGC
GGTTCCCGGCATGACTTGCGCCGCCTGCCCGATCACAGTCAAGAAAGCGCTCTCCAAGGTCGAAGGCGTGAGCAAGGTCG
ATGTGGGCTTCGAGAAGCGCGAGGCCGTCGTCACTTTTGACGACACCAAGGCCAGCGTACAGAAGCTGACCAAGGCCACC
GCAGACGCCGGCTATCCGTCCAGCGTCAAGCAGTGA

Protein sequence :
MKKLFASLALAAAVAPVWAATQTVTLAVPGMTCAACPITVKKALSKVEGVSKVDVGFEKREAVVTFDDTKASVQKLTKAT
ADAGYPSSVKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ABQ57373.1 MerP Not tested SGI1 Protein 7e-25 100
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 7e-25 100
merP AFG30122.1 MerP Not tested PAGI-2 Protein 7e-25 100
merP AGK07023.1 MerP Not tested SGI1 Protein 7e-25 100
merP AGK07081.1 MerP Not tested SGI1 Protein 7e-25 100
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 1e-24 100
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 1e-21 81
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 7e-22 81
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 5e-22 81

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NRG857_30139 YP_006162260.1 mercury resistance operon mercuric transport protein MerP; periplasmic component BAC0679 Protein 1e-22 88
NRG857_30139 YP_006162260.1 mercury resistance operon mercuric transport protein MerP; periplasmic component BAC0678 Protein 7e-23 88
NRG857_30139 YP_006162260.1 mercury resistance operon mercuric transport protein MerP; periplasmic component BAC0231 Protein 3e-22 85
NRG857_30139 YP_006162260.1 mercury resistance operon mercuric transport protein MerP; periplasmic component BAC0675 Protein 4e-19 70
NRG857_30139 YP_006162260.1 mercury resistance operon mercuric transport protein MerP; periplasmic component BAC0674 Protein 8e-16 60