Gene Information

Name : NRG857_30132 (NRG857_30132)
Accession : YP_006162256.1
Strain :
Genome accession: NC_017659
Putative virulence/resistance : Resistance
Product : mercury resistance operon mercuric resistance protein MerE
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 69962 - 70198 bp
Length : 237 bp
Strand : -
Note : Sequence similarity to: NP_052887.1 putative mercury resistance protein [Plasmid R100]; pfam05052, MerE, MerE protein

DNA sequence :
GTGAACGCCCCTGACAAACTGCCGCCCGAGACGCGCCAACCCGTTTCCGGCTACCTGTGGGGTGCGCTGGCCGTGTTGAC
CTGCCCCTGCCATCTGCCGATTCTCGCCGCCGTGCTGGCCGGGACGACCGCCGGTGCCTTCCTTGGCGAGCATTGGGGTG
TTGCCGCGCTCGCGCTGACCGGCTTGTTCGTTCTGGCCGTAACGCGGCTGCTGCGCGCCTTCCGGGGCGGATCATGA

Protein sequence :
MNAPDKLPPETRQPVSGYLWGALAVLTCPCHLPILAAVLAGTTAGAFLGEHWGVAALALTGLFVLAVTRLLRAFRGGS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merE ACF06180.1 mercuric resistance protein Not tested Tn5036-like Protein 2e-23 100
merE AET25395.1 MerE Not tested PAGI-2(C) Protein 2e-23 100
merE AFG30118.1 MerE Not tested PAGI-2 Protein 2e-23 100
merE YP_006098385.1 putative mercury resistance protein Not tested Tn2411 Protein 2e-23 100
merE CAJ77058.1 Hypothetical protein Not tested AbaR1 Protein 9e-21 82
merE ACN81003.1 MerE Not tested AbaR5 Protein 1e-20 82
merE AGK07077.1 MerE Not tested SGI1 Protein 2e-18 75
merE ABQ57369.1 MerE Not tested SGI1 Protein 2e-18 75
merE AGK07019.1 MerE Not tested SGI1 Protein 2e-18 75

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NRG857_30132 YP_006162256.1 mercury resistance operon mercuric resistance protein MerE BAC0672 Protein 3e-20 79
NRG857_30132 YP_006162256.1 mercury resistance operon mercuric resistance protein MerE BAC0670 Protein 1e-20 79
NRG857_30132 YP_006162256.1 mercury resistance operon mercuric resistance protein MerE BAC0673 Protein 1e-18 75
NRG857_30132 YP_006162256.1 mercury resistance operon mercuric resistance protein MerE BAC0671 Protein 1e-18 75