Gene Information

Name : ECO55CA74_17385 (ECO55CA74_17385)
Accession : YP_006160593.1
Strain : Escherichia coli RM12579
Genome accession: NC_017656
Putative virulence/resistance : Unknown
Product : IS66 family transposase orfB
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3615924 - 3616274 bp
Length : 351 bp
Strand : +
Note : COG3436 Transposase and inactivated derivatives

DNA sequence : 
ATGATTTCACTCCCATCAGGTACCCGTATCTGGCTCGTTGCCGGCGTTACCGATATGTGTAAATCCTTCAACGGACTGGG
AGAACAGGTACAACATGTGCTGAATGATAATCCCTTCTCCGGTCACCTGTTTATCTTCCGTGGCCGACGGGGGGACACCG
TTAAAATTCTTTGGGCTGATGCTGATGGTCTGTGCCTGTTCACCAAACGCCTGGAGGAAGGCCAGTTTATCTGGCCTGCG
GTGCGTGACGGTAAGGTATCCATTACCCGCTCGCAACTGGCAATGCTCCTCGATAAGCTGGACTGGCGTCAGCCAAAAAC
ATCCCGCCTTAACGCCCTGACAATGTTGTAA

Protein sequence : 
MISLPSGTRIWLVAGVTDMCKSFNGLGEQVQHVLNDNPFSGHLFIFRGRRGDTVKILWADADGLCLFTKRLEEGQFIWPA
VRDGKVSITRSQLAMLLDKLDWRQPKTSRLNALTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 4e-50 100
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 4e-50 100
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 8e-49 97
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 8e-49 97
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-48 96
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 6e-38 69
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 6e-38 69
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-37 68
unnamed AAL08461.1 unknown Not tested SRL Protein 9e-35 67
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-34 66
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-34 66
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-34 66
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-34 66
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-34 66
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-34 66
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-34 66
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-34 66
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-34 66
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-34 66
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-25 66
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-33 65
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-33 65
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 8e-34 63
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 8e-34 63
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-26 58

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECO55CA74_17385 YP_006160593.1 IS66 family transposase orfB VFG1737 Protein 3e-49 96
ECO55CA74_17385 YP_006160593.1 IS66 family transposase orfB VFG1665 Protein 6e-38 68
ECO55CA74_17385 YP_006160593.1 IS66 family transposase orfB VFG1052 Protein 4e-35 67
ECO55CA74_17385 YP_006160593.1 IS66 family transposase orfB VFG0792 Protein 5e-35 66
ECO55CA74_17385 YP_006160593.1 IS66 family transposase orfB VFG1698 Protein 7e-35 66
ECO55CA74_17385 YP_006160593.1 IS66 family transposase orfB VFG1709 Protein 5e-35 66
ECO55CA74_17385 YP_006160593.1 IS66 family transposase orfB VFG1517 Protein 7e-26 66