Name : i14_4161 (i14_4161) Accession : YP_006156230.1 Strain : Escherichia coli clone D i14 Genome accession: NC_017652 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 4155635 - 4155853 bp Length : 219 bp Strand : - Note : - DNA sequence : ATGAGCAATCAACTGAATACCGATACTGACCTGATGAATGACAAACTGGTGACGATGGCATTTATTACCACGTTTACTGG CCTGACTGACAAATGGTTTTATAAACTGATTAGTGAAGGCAAGTTTCCAAAGCCTATCAAACTGGGGCGTAGTTCCCGCT GGCGGGAAAGTGAAGTTAAACGCTGGCTGACGGAACGTATTGAAGAATCCCGCTATTAA Protein sequence : MSNQLNTDTDLMNDKLVTMAFITTFTGLTDKWFYKLISEGKFPKPIKLGRSSRWRESEVKRWLTERIEESRY |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 4e-18 | 73 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 6e-18 | 73 |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 6e-18 | 68 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 7e-18 | 66 |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 5e-18 | 66 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 1e-17 | 66 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 1e-17 | 66 |
unnamed | CAI43835.1 | hypothetical protein | Not tested | LEE | Protein | 2e-17 | 65 |
unnamed | ADD91712.1 | putative transcriptional regulator AlpA | Not tested | PAI-I AL862 | Protein | 2e-17 | 65 |
unnamed | AAL08466.1 | unknown | Not tested | SRL | Protein | 1e-17 | 63 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
i14_4161 | YP_006156230.1 | hypothetical protein | VFG1480 | Protein | 2e-18 | 73 |
i14_4161 | YP_006156230.1 | hypothetical protein | VFG0651 | Protein | 3e-18 | 66 |
i14_4161 | YP_006156230.1 | hypothetical protein | VFG1057 | Protein | 5e-18 | 63 |