Gene Information

Name : i02_4881 (i02_4881)
Accession : YP_006152017.1
Strain : Escherichia coli clone D i2
Genome accession: NC_017651
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4905509 - 4905715 bp
Length : 207 bp
Strand : +
Note : -

DNA sequence : 
ATGACCCCCCCAGTTTCGCTGATGGATGACCAGATGGTCGATATGGCGTTTATCACTCAGCTGACCGGCCTGACCGATAA
GTGGTTTTACAAGCTCATCAAGGATGGGGCCTTTCCGGCTCCCATCAAACTCGGCCGCAGCTCCCGCTGGCTGAAAAGTG
AAGTGGAAGCCTGGCTGCAGGCGCGTATTACACAGTCCCGTCCGTAA

Protein sequence : 
MTPPVSLMDDQMVDMAFITQLTGLTDKWFYKLIKDGAFPAPIKLGRSSRWLKSEVEAWLQARITQSRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 2e-26 98
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 1e-25 93
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 1e-25 93
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 8e-26 92
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 2e-25 92
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 1e-25 92
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 1e-25 92
unnamed AAL08466.1 unknown Not tested SRL Protein 8e-26 92
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 1e-14 70
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 1e-14 70
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-17 70
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 8e-18 70

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
i02_4881 YP_006152017.1 hypothetical protein VFG0651 Protein 3e-26 92
i02_4881 YP_006152017.1 hypothetical protein VFG1057 Protein 3e-26 92
i02_4881 YP_006152017.1 hypothetical protein VFG1480 Protein 3e-18 70