Gene Information

Name : yeeU (CE10_4284)
Accession : YP_006146270.1
Strain : Escherichia coli CE10
Genome accession: NC_017646
Putative virulence/resistance : Virulence
Product : CP4-44 prophage, antitoxin of the YeeV-YeeU toxin-antitoxin system
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4355442 - 4355810 bp
Length : 369 bp
Strand : +
Note : -

DNA sequence :
GTGTCAGACACACTCCCCGGGACAACGCTTCCCGACGACAATAACGACCGCACCTGGTGGGGACTGCCCTGCACCGTGAC
GTCCTGTTTTGGTGCCCGTCTGGTACAGGAAGGCAACCGGTTGCATTACCTTGCCGACCGCGCCGGTATCAGAGGGCGGT
TCAGCGACGCGGATTCGTACCACCTGGACCAGGCCTTTCCGCTGCTGATGAAACAACTGGAACTCATGCTCACCAGCGGT
GAACTGAATCCCCGCCATCAGCATACCGTCACGCTGTATGCAAAAGGGCTGACCTGCGAAGCCGACACCCTCGGCAGTTG
TGGCTACGTTTATATGGCTGTTTATCCGACGCCCGAAACGAAAAAGTAA

Protein sequence :
MSDTLPGTTLPDDNNDRTWWGLPCTVTSCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeU CAD42100.1 hypothetical protein Not tested PAI II 536 Protein 6e-52 96
c5150 NP_756998.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-50 93
yeeU CAE85203.1 YeeU protein Not tested PAI V 536 Protein 8e-51 93
yeeU YP_853121.1 antitoxin of the YeeV-YeeU toxin-antitoxin system Virulence PAI IV APEC-O1 Protein 2e-50 92
aec75 AAW51758.1 Aec75 Not tested AGI-3 Protein 8e-51 92
yeeU NP_708772.1 structural protein Not tested SHI-1 Protein 2e-50 92
yeeU NP_838486.1 structural protein Not tested SHI-1 Protein 2e-50 92
yeeU YP_854324.1 hypothetical protein Not tested PAI I APEC-O1 Protein 2e-50 92
yeeU AAZ04460.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 1e-50 92
unnamed CAD66206.1 hypothetical protein Not tested PAI III 536 Protein 2e-49 91
yeeU ADD91700.1 YeeU Not tested PAI-I AL862 Protein 4e-50 91
unnamed AAK00481.1 unknown Not tested SHI-1 Protein 3e-50 91
ECO103_3591 YP_003223448.1 hypothetical protein Not tested LEE Protein 1e-47 90
unnamed AAL67343.1 intergenic-region protein Not tested PAI II CFT073 Protein 5e-48 90
Z1220 NP_286755.1 structural protein Not tested TAI Protein 2e-47 89
Z1658 NP_287161.1 structural protein Not tested TAI Protein 2e-47 89
unnamed CAI43903.1 hypothetical protein Not tested LEE Protein 2e-47 87
unnamed AAL08477.1 unknown Not tested SRL Protein 4e-47 86
unnamed AAL57576.1 unknown Not tested LEE Protein 3e-47 86

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yeeU YP_006146270.1 CP4-44 prophage, antitoxin of the YeeV-YeeU toxin-antitoxin system VFG1619 Protein 3e-52 96
yeeU YP_006146270.1 CP4-44 prophage, antitoxin of the YeeV-YeeU toxin-antitoxin system VFG0662 Protein 6e-51 92
yeeU YP_006146270.1 CP4-44 prophage, antitoxin of the YeeV-YeeU toxin-antitoxin system VFG1681 Protein 7e-50 91
yeeU YP_006146270.1 CP4-44 prophage, antitoxin of the YeeV-YeeU toxin-antitoxin system VFG1068 Protein 2e-47 86